MCA_05518_1

Protein

Length

208 amino acids

Gene name: POP5

Description: Ribonuclease P/MRP protein subunit POP5

Browser: contigD:1532024-1532651+

RNA-seq: read pairs 172, FPKM 10.2, percentile rank 26.2% (100% = highest expression)

Protein function

Annotation:		POP5	Ribonuclease P/MRP protein subunit POP5
KEGG:	K03537	POP5	ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5]
EGGNOG:	0PSB4	PGUG_04645	P MRP protein subunit POP5
SGD closest match:	S000000031	POP5	Ribonuclease P/MRP protein subunit POP5
CGD closest match:	CAL0000180724	orf19.275	Ribonuclease P/MRP protein subunit POP5

Protein alignments

	%id	Aln length	E-value
MIA_00418_1	43.09%	181	4e-40	MIA_00418_1
UniRef50_Q9UU90	41.42%	169	2e-29	Ribonuclease P/MRP protein subunit POP5 n=4 Tax=Taphrinomycotina TaxID=451866 RepID=POP5_SCHPO
A0A167FYT6_9ASCO	39.43%	175	1e-30	Ribonuclease P/MRP protein subunit POP5 OS=Sugiyamaella lignohabitans GN=POP5 PE=3 SV=1
A0A060TB49_BLAAD	39.26%	163	3e-30	Ribonuclease P/MRP protein subunit POP5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B12848g PE=3 SV=1
A0A1E3PE08_9ASCO	35.88%	170	4e-29	Ribonucleases P/MRP protein subunit POP5 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14877 PE=4 SV=1
A0A0J9XEX9_GEOCN	39.64%	169	5e-25	Similar to Saccharomyces cerevisiae YAL033W POP5 Subunit of both RNase MRP and nuclear RNase P OS=Geotrichum candidum GN=BN980_GECA12s03387g PE=4 SV=1
Q6CFQ6_YARLI	33.14%	169	9e-25	Ribonuclease P/MRP protein subunit POP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04752g PE=3 SV=1
Q5AEJ3_CANAL	35.20%	179	3e-22	Ribonuclease P/MRP protein subunit POP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.275 PE=3 SV=1
A0A1E4TBN7_9ASCO	28.74%	167	2e-18	Ribonuclease P/MRP protein subunit POP5 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134402 PE=3 SV=1
POP5_YEAST	29.12%	182	2e-15	Ribonuclease P/MRP protein subunit POP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP5 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3965

Protein family membership

Ribonuclease P/MRP protein subunit (IPR002759)
- Ribonuclease P/MRP protein subunit Pop5 (IPR016819)

Domains and repeats

None predicted.

Detailed signature matches

IPR002759

Ribonuclease P/MRP protein subunit
1. PF01900 (RNase_P_Rpp14)
  
  7 - 159
  
  Pfam
  PF01900 (RNase_P_Rpp14)
IPR016819

Ribonuclease P/MRP protein subunit Pop5
1. PIRSF023803 (RNase_P)
  
  1 - 29
  
  PIRSF
  PIRSF023803 (RNase_P)
  
  63 - 208
  
  PIRSF
  PIRSF023803 (RNase_P)

no IPR

Unintegrated signatures

SSF160350 (Rnp2-like)

68 - 163

SUPERFAMILY
SSF160350 (Rnp2-like)

1 - 17

SUPERFAMILY
SSF160350 (Rnp2-like)
mobidb-lite (disord...)

21 - 55

MobiDB Lite
mobidb-lite (disorder_prediction)

Protein sequence

>MCA_05518_1
MVRLKTRYILFEILHPQNLATIPTVPDPKDQHDNNNNNSDQRHNNTTSSPSPLDLDPKVATALSLRHSVDSIETYSLLKL
IREAVEQNFGVQGAGSVKDNLILKYFSPRTHVGILRVSRPYVRKAWASLSLINKINDRPVIIKVLRVSGTIQKSEKAAIQ
RDKYMIQMVYSNNESQVDSEKKKLDLLLKSVVTDDQEVLDIEDDDKED

GO term prediction

Biological Process

GO:0008033 tRNA processing
GO:0016070 RNA metabolic process

Molecular Function

GO:0004526 ribonuclease P activity
GO:0004540 ribonuclease activity

Cellular Component