Protein
MCA_05518_1
Length
208 amino acids
Gene name: POP5
Description: Ribonuclease P/MRP protein subunit POP5
Browser: contigD:1532024-1532651+
RNA-seq: read pairs 172, FPKM 10.2, percentile rank 26.2% (100% = highest expression)
Protein function
| Annotation: | POP5 | Ribonuclease P/MRP protein subunit POP5 | |
|---|---|---|---|
| KEGG: | K03537 | POP5 | ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5] |
| EGGNOG: | 0PSB4 | PGUG_04645 | P MRP protein subunit POP5 |
| SGD closest match: | S000000031 | POP5 | Ribonuclease P/MRP protein subunit POP5 |
| CGD closest match: | CAL0000180724 | orf19.275 | Ribonuclease P/MRP protein subunit POP5 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00418_1 | 43.09% | 181 | 4e-40 | MIA_00418_1 |
| UniRef50_Q9UU90 | 41.42% | 169 | 2e-29 | Ribonuclease P/MRP protein subunit POP5 n=4 Tax=Taphrinomycotina TaxID=451866 RepID=POP5_SCHPO |
| A0A167FYT6_9ASCO | 39.43% | 175 | 1e-30 | Ribonuclease P/MRP protein subunit POP5 OS=Sugiyamaella lignohabitans GN=POP5 PE=3 SV=1 |
| A0A060TB49_BLAAD | 39.26% | 163 | 3e-30 | Ribonuclease P/MRP protein subunit POP5 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B12848g PE=3 SV=1 |
| A0A1E3PE08_9ASCO | 35.88% | 170 | 4e-29 | Ribonucleases P/MRP protein subunit POP5 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_14877 PE=4 SV=1 |
| A0A0J9XEX9_GEOCN | 39.64% | 169 | 5e-25 | Similar to Saccharomyces cerevisiae YAL033W POP5 Subunit of both RNase MRP and nuclear RNase P OS=Geotrichum candidum GN=BN980_GECA12s03387g PE=4 SV=1 |
| Q6CFQ6_YARLI | 33.14% | 169 | 9e-25 | Ribonuclease P/MRP protein subunit POP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04752g PE=3 SV=1 |
| Q5AEJ3_CANAL | 35.20% | 179 | 3e-22 | Ribonuclease P/MRP protein subunit POP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.275 PE=3 SV=1 |
| A0A1E4TBN7_9ASCO | 28.74% | 167 | 2e-18 | Ribonuclease P/MRP protein subunit POP5 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_134402 PE=3 SV=1 |
| POP5_YEAST | 29.12% | 182 | 2e-15 | Ribonuclease P/MRP protein subunit POP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP5 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3965
Protein family membership
- Ribonuclease P/MRP protein subunit (IPR002759)
- Ribonuclease P/MRP protein subunit Pop5 (IPR016819)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF01900 (RNase_P_Rpp14)
-
-
-
PIRSF023803 (RNase_P)
-
no IPR
Unintegrated signatures
-
SSF160350 (Rnp2-like)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05518_1 MVRLKTRYILFEILHPQNLATIPTVPDPKDQHDNNNNNSDQRHNNTTSSPSPLDLDPKVATALSLRHSVDSIETYSLLKL IREAVEQNFGVQGAGSVKDNLILKYFSPRTHVGILRVSRPYVRKAWASLSLINKINDRPVIIKVLRVSGTIQKSEKAAIQ RDKYMIQMVYSNNESQVDSEKKKLDLLLKSVVTDDQEVLDIEDDDKED
GO term prediction
Biological Process
GO:0008033 tRNA processing
GO:0016070 RNA metabolic process
Molecular Function
GO:0004526 ribonuclease P activity
GO:0004540 ribonuclease activity
Cellular Component
None predicted.