Protein

MIA_00363_1

Length
226 amino acids

Browser: contig01:1042595-1043276-

Protein function

EGGNOG:0PFN9MRPL16mitochondrial 54S ribosomal protein YmL47
SGD closest match:S000000134MRPL1654S ribosomal protein L16, mitochondrial
CGD closest match:CAL0000192561orf19.2019Mitochondrial 54S ribosomal protein YmL47

Protein alignments

%idAln lengthE-value
MCA_05698_175.556%2257.14e-128MCA_05698_1
A0A0J9X6Z5_GEOCN73.182%2204.63e-115Similar to Saccharomyces cerevisiae YBL038W MRPL16 Mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA04s01891g PE=3 SV=1
A0A060T2G6_BLAAD60.811%2223.21e-93ARAD1C25102p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C25102g PE=3 SV=1
A0A167F198_9ASCO60.766%2099.39e-86Mitochondrial 54S ribosomal protein YmL47 OS=Sugiyamaella lignohabitans GN=MRPL16 PE=3 SV=1
UniRef50_A0A1S7HLD661.290%2171.54e-81MRPL16 (YBL038W) n=9 Tax=Saccharomycetales TaxID=4892 RepID=A0A1S7HLD6_9SACH
A0A1E3PDT8_9ASCO56.889%2252.13e-79Phenylalanyl-tRNA synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53230 PE=4 SV=1
RM16_YEAST61.033%2131.44e-8354S ribosomal protein L16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL16 PE=1 SV=1
A0A1D8PG94_CANAL55.208%1922.36e-72Mitochondrial 54S ribosomal protein YmL47 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2019 PE=3 SV=1
Q6CBJ9_YARLI46.860%2072.14e-55YALI0C18139p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C18139g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9508
Predicted cleavage: 78

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 226

Detailed signature matches

  1. Family IPR000114
    Ribosomal protein L16
    1. TIGR01164
    2. PR00060 (RIBOSOMALL16)
  2. Domain IPR016180
    Ribosomal protein L10e/L16
    1. cd01433 (Ribosomal_...)
    2. SSF54686 (Ribosomal...)
    3. PF00252 (Ribosomal_L16)
    4. G3DSA:3.90.11...
  3. SITE IPR020798
    Ribosomal protein L16, conserved site
    1. PS00701 (RIBOSOMAL_...)

Residue annotation

  1. 23S rRNA interface...
  2. 5S rRNA interface ...
  3. putative antibioti...
  4. L25 interface cd01...
  5. L27 interface cd01...

Protein sequence

>MIA_00363_1
MFDAKSALTLFRSSLKQLSTAIPSASSLNIPSAVRFKHEYAPRFVKVGKKHKGRVPVRIGGSIKGSTLQFGQFGLRLKSD
GVRLAAIQLKEADNWLMRIMRANGAQLIRRLQTNIAVCVKGNETRMGKGKGPFDHWAVRVPTGKILFEINGPNLHEQVAR
DAFRVAADKLPGIYEVVTLSDKPKAGFERVEVPEKINVVQNMLANPTKRMANILKSKEDFYKKYRR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome