Protein

MIA_00345_1

Length
260 amino acids

Browser: contig01:992230-993083+

Protein function

EGGNOG:0PI7BSSN8Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II- dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II
SGD closest match:S000004970SSN8RNA polymerase II holoenzyme cyclin-like subunit
CGD closest match:CAL0000180084SSN8RNA polymerase II holoenzyme cyclin-like subunit

Protein alignments

%idAln lengthE-value
MCA_01216_161.303%2613.12e-124MCA_01216_1
A0A0J9X555_GEOCN63.675%2342.93e-116Similar to Saccharomyces cerevisiae YNL025C SSN8 Cyclin-like component of the RNA polymerase II holoenzyme OS=Geotrichum candidum GN=BN980_GECA02s08348g PE=3 SV=1
UniRef50_A0A0J9X55563.675%2346.00e-113Similar to Saccharomyces cerevisiae YNL025C SSN8 Cyclin-like component of the RNA polymerase II holoenzyme n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X555_GEOCN
A0A060TD44_BLAAD56.977%2588.85e-112ARAD1B21450p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B21450g PE=3 SV=1
SSN8_YARLI53.846%2475.03e-106RNA polymerase II holoenzyme cyclin-like subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SSN8 PE=3 SV=1
A0A1E3PPC6_9ASCO53.226%2486.88e-96Cyclin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81815 PE=3 SV=1
A0A1E4TIG6_9ASCO46.341%2467.40e-79Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29937 PE=3 SV=1
SSN8_YEAST47.177%2486.60e-75RNA polymerase II holoenzyme cyclin-like subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSN8 PE=1 SV=1
SSN8_CANAL55.495%1825.90e-70RNA polymerase II holoenzyme cyclin-like subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSN8 PE=3 SV=1
A0A161HLN0_9ASCO25.309%1623.69e-09TFIIH complex kinase subunit CCL1 OS=Sugiyamaella lignohabitans GN=CCL1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0059

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 260

Detailed signature matches

  1. Domain IPR013763
    Cyclin-like
    1. G3DSA:1.10.47...
    2. SSF47954 (Cyclin-like)
    3. cd00043 (CYCLIN)
  2. Domain IPR006671
    Cyclin, N-terminal
    1. PF00134 (Cyclin_N)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. PIRSF028758 (Cyclin...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)

Residue annotation

  1. binding site 1 cd0...
  2. binding site 2 cd0...

Protein sequence

>MIA_00345_1
MKVRQWDYDEGKIANLNDDTLYDNMRLYFHSLVGSLGRQLRVRQRVIGTAEVYLTRFFTRISFFEVNAYAMVTTCVYVAC
KTEEYPQHIRNVTNEARSLWPEYVSTDLTKIAECEFYLIEELDSYLVVYHPYRSLIQLTESLTLANTQLTLLSEEIQSAW
SMINDSYATDMLLLYPPHIIAMACLYITLVVRTPLMKQSRPYESVKTKFDQFVFFLGNSGIDLESVIDVIQELISLYVRW
ESYDESSCKLILSKHILSSV

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.