Protein
MCA_01216_1
Length
312 amino acids
Gene name: SSN8
Description: RNA polymerase II holoenzyme cyclin-like subunit
Browser: contigA:3842228-3843352+
RNA-seq: read pairs 147, FPKM 5.8, percentile rank 18.8% (100% = highest expression)
Protein function
| Annotation: | SSN8 | RNA polymerase II holoenzyme cyclin-like subunit | |
|---|---|---|---|
| KEGG: | K15161 | CCNC | cyclin-C |
| EGGNOG: | 0PI7B | SSN8 | Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II- dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II |
| SGD closest match: | S000004970 | SSN8 | RNA polymerase II holoenzyme cyclin-like subunit |
| CGD closest match: | CAL0000180084 | SSN8 | RNA polymerase II holoenzyme cyclin-like subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00345_1 | 61.30% | 261 | 2e-122 | MIA_00345_1 |
| A0A0J9X555_GEOCN | 54.55% | 275 | 1e-113 | Similar to Saccharomyces cerevisiae YNL025C SSN8 Cyclin-like component of the RNA polymerase II holoenzyme OS=Geotrichum candidum GN=BN980_GECA02s08348g PE=3 SV=1 |
| UniRef50_A0A0J9X555 | 54.55% | 275 | 3e-110 | Similar to Saccharomyces cerevisiae YNL025C SSN8 Cyclin-like component of the RNA polymerase II holoenzyme n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X555_GEOCN |
| A0A060TD44_BLAAD | 50.87% | 287 | 9e-109 | ARAD1B21450p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B21450g PE=3 SV=1 |
| SSN8_YARLI | 47.18% | 284 | 5e-93 | RNA polymerase II holoenzyme cyclin-like subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SSN8 PE=3 SV=1 |
| SSN8_YEAST | 43.65% | 307 | 4e-83 | RNA polymerase II holoenzyme cyclin-like subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSN8 PE=1 SV=1 |
| SSN8_CANAL | 53.12% | 224 | 7e-80 | RNA polymerase II holoenzyme cyclin-like subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSN8 PE=3 SV=1 |
| A0A1E3PPC6_9ASCO | 44.96% | 258 | 7e-80 | Cyclin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81815 PE=3 SV=1 |
| A0A1E4TIG6_9ASCO | 41.87% | 289 | 2e-75 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_29937 PE=3 SV=1 |
| A0A167EH69_9ASCO | 25.00% | 140 | 3e-08 | Ctk2p OS=Sugiyamaella lignohabitans GN=CTK2 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6998
Predicted cleavage: 32
Protein family membership
None predicted.
Domains and repeats
-
Domain
-
Domain
1
50
100
150
200
250
312
Detailed signature matches
no IPR
Unintegrated signatures
-
PIRSF028758 (Cyclin...)
-
Residue annotation
-
binding site 1 cd0...
-
binding site 2 cd0...
Protein sequence
>MCA_01216_1 MVVFFFTKKIKPFPFNTSKTTRSFSANYWASTQRHKWQYTKASLQETRQQVRRWDQENGYVANADDPTLYNNLRLYFHNL IKQLGRQLNVRQRALGTAEVYFIRFFSQNSFFEVNVYAMIATCVYVACKTEECPQHIRTITSEAKSLWPEYISPDPTKIA ECEFYLIEELESYLIVYHPYRSLMQISESLALFDSKLTISDDELQPIWSLINDSYATDMMLIYPPHIIATACVYVSLLFR SIVVDGLRNQLKAKYDGLIAFLGNTGIDVAAVVEAIQEMISLYTRWAKFEDGSYNSICRSILSKHLLSDNAS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.