MIA_00329_1

Browser: contig01:954501-954776+

Protein function

SGD closest match:	S000003310	PAC10	Prefoldin subunit 3
CGD closest match:	CAL0000183866	orf19.5985	Prefoldin subunit 3

Protein alignments

	%id	Aln length	E-value
MCA_01221_1	69.565%	46	4.57e-18	MCA_01221_1
A0A0J9YHI3_GEOCN	64.444%	45	1.39e-16	Prefoldin subunit 3 OS=Geotrichum candidum GN=BN980_GECA01s04883g PE=3 SV=1
A0A1E3PMG2_9ASCO	66.667%	36	2.44e-13	Prefoldin subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50547 PE=3 SV=1
A0A060THT6_BLAAD	60.976%	41	7.77e-13	Prefoldin subunit 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40546g PE=3 SV=1
UniRef50_A0A060THT6	60.976%	41	1.92e-09	Prefoldin subunit 3 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060THT6_BLAAD
A0A1E4TF12_9ASCO	47.368%	38	6.58e-09	Prefoldin subunit 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1989 PE=3 SV=1
PFD3_YEAST	42.857%	42	8.13e-08	Prefoldin subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC10 PE=1 SV=1
Q6CFA5_YARLI	56.757%	37	1.54e-07	Prefoldin subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08844g PE=3 SV=1
A0A1D8PK48_CANAL	58.621%	29	8.53e-07	Prefoldin subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5985 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1724
Predicted cleavage: 35

Protein family membership

None predicted.

Domains and repeats

Protein sequence

>MIA_00329_1
MATATTSSASIPLKNFFDITKTNPRGIPQAPFVEKVEDFVKFSDDVQLVLSKFEDMIQ

GO term prediction