Protein
MCA_01221_1
Length
194 amino acids
Browser: contigA:3850468-3851440-
RNA-seq: read pairs 757, FPKM 48.0, percentile rank 64.5% (100% = highest expression)
Protein function
| EGGNOG: | 0PMX5 | PGUG_04210 | prefoldin subunit |
|---|---|---|---|
| SGD closest match: | S000003310 | PAC10 | Prefoldin subunit 3 |
| CGD closest match: | CAL0000183866 | orf19.5985 | Prefoldin subunit 3 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9YHI3_GEOCN | 69.78% | 182 | 2e-92 | Prefoldin subunit 3 OS=Geotrichum candidum GN=BN980_GECA01s04883g PE=3 SV=1 |
| A0A1E3PMG2_9ASCO | 71.93% | 171 | 2e-86 | Prefoldin subunit 3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50547 PE=3 SV=1 |
| A0A060THT6_BLAAD | 58.90% | 163 | 2e-70 | Prefoldin subunit 3 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40546g PE=3 SV=1 |
| UniRef50_A0A060THT6 | 58.90% | 163 | 4e-67 | Prefoldin subunit 3 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060THT6_BLAAD |
| Q6CFA5_YARLI | 61.82% | 165 | 8e-67 | Prefoldin subunit 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B08844g PE=3 SV=1 |
| A0A1E4TF12_9ASCO | 55.42% | 166 | 6e-65 | Prefoldin subunit 3 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1989 PE=3 SV=1 |
| A0A1D8PK48_CANAL | 53.11% | 177 | 2e-61 | Prefoldin subunit 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5985 PE=3 SV=1 |
| MIA_00330_1 | 68.00% | 125 | 3e-59 | MIA_00330_1 |
| PFD3_YEAST | 48.60% | 179 | 7e-54 | Prefoldin subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAC10 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0644
Protein family membership
- Prefoldin alpha-like (IPR004127)
- Prefoldin subunit 3 (IPR016655)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF02996 (Prefoldin)
-
-
-
PIRSF016396 (Prefol...)
-
no IPR
Unintegrated signatures
-
-
-
SSF46579 (Prefoldin)
Protein sequence
>MCA_01221_1 MSVQNPPAQISKFFEITKTNPSGIPQAPFVERVEDVVKSQDQVDLVLSRFQDMLQKYKFMETSSLRRAAGLKEKIPDIEK TLDMVQFLDSKKDSGESFVTSYELNDTVYAKAEITPSKTVYLWLGANVMLEYTIEEAVKLLQERLDTAKQTLKTCEEDLE FLRENITTMEVNTARVYNWDVQKRRELKLKEEGK
GO term prediction
Biological Process
GO:0006457 protein folding
Molecular Function
None predicted.
Cellular Component
GO:0016272 prefoldin complex