Protein
MIA_00310_1
Length
120 amino acids
Browser: contig01:891143-891583+
Protein function
| EGGNOG: | 0PRXJ | PGUG_02186 | ribosomal protein L34 |
|---|---|---|---|
| SGD closest match: | S000002522 | YDR115W | 54S ribosomal protein L34, mitochondrial |
| CGD closest match: | CAL0000186624 | orf19.961.2 | Putative mitochondrial 54S ribosomal protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_06412_1 | 60.40% | 101 | 9e-31 | MCA_06412_1 |
| A0A0J9XHB3_GEOCN | 50.85% | 118 | 4e-26 | Similar to Saccharomyces cerevisiae YDR115W Putative mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA16s03145g PE=3 SV=1 |
| UniRef50_A0A0J9XHB3 | 50.85% | 118 | 9e-23 | Similar to Saccharomyces cerevisiae YDR115W Putative mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHB3_GEOCN |
| A0A060T473_BLAAD | 76.00% | 50 | 2e-21 | ARAD1C42218p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42218g PE=3 SV=1 |
| RM34_YEAST | 78.00% | 50 | 4e-21 | 54S ribosomal protein L34, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR115W PE=1 SV=1 |
| A0A1D8PMX3_CANAL | 74.00% | 50 | 9e-20 | Putative mitochondrial 54S ribosomal protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.961.2 PE=3 SV=1 |
| A0A1E4TJG6_9ASCO | 74.00% | 50 | 4e-19 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20800 PE=3 SV=1 |
| A0A1E3PKJ5_9ASCO | 60.00% | 50 | 7e-17 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46468 PE=3 SV=1 |
| Q6C9A1_YARLI | 60.78% | 51 | 2e-13 | YALI0D12793p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12793g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9933
Predicted cleavage: 42
Protein family membership
- Ribosomal protein L34 (IPR000271)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MIA_00310_1 MLSRFTAIRPAIRVVASGVSSRPLTLLAVQSNPLTALRARMAPGSPTAAVALPLAQPNPLLLPSLPDLLDQRRWKARGNT YQPSTLKRKRVNGFLARLKTRGGRKVLARRKTKGRWFLSH
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome