Protein
MCA_06412_1
Length
119 amino acids
Description: 54S ribosomal protein L34, mitochondrial
Browser: contigD:4129877-4130303-
RNA-seq: read pairs 2333, FPKM 240.2, percentile rank 90.1% (100% = highest expression)
Protein function
| Annotation: | 54S ribosomal protein L34, mitochondrial | ||
|---|---|---|---|
| KEGG: | K02914 | RP-L34 | large subunit ribosomal protein L34 |
| EGGNOG: | 0PRXJ | PGUG_02186 | ribosomal protein L34 |
| SGD closest match: | S000002522 | YDR115W | 54S ribosomal protein L34, mitochondrial |
| CGD closest match: | CAL0000186624 | orf19.961.2 | Putative mitochondrial 54S ribosomal protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00310_1 | 69.31% | 101 | 5e-34 | MIA_00310_1 |
| A0A0J9XHB3_GEOCN | 53.85% | 104 | 1e-30 | Similar to Saccharomyces cerevisiae YDR115W Putative mitochondrial ribosomal protein of the large subunit OS=Geotrichum candidum GN=BN980_GECA16s03145g PE=3 SV=1 |
| UniRef50_A0A0J9XHB3 | 53.85% | 104 | 2e-27 | Similar to Saccharomyces cerevisiae YDR115W Putative mitochondrial ribosomal protein of the large subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XHB3_GEOCN |
| A0A1D8PMX3_CANAL | 53.12% | 96 | 2e-23 | Putative mitochondrial 54S ribosomal protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.961.2 PE=3 SV=1 |
| A0A060T473_BLAAD | 38.97% | 136 | 2e-22 | ARAD1C42218p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42218g PE=3 SV=1 |
| RM34_YEAST | 60.00% | 70 | 4e-22 | 54S ribosomal protein L34, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR115W PE=1 SV=1 |
| A0A1E3PKJ5_9ASCO | 58.21% | 67 | 8e-21 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46468 PE=3 SV=1 |
| A0A1E4TJG6_9ASCO | 57.75% | 71 | 3e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_20800 PE=3 SV=1 |
| Q6C9A1_YARLI | 54.90% | 51 | 2e-12 | YALI0D12793p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12793g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9873
Predicted cleavage: 42
Protein family membership
- Ribosomal protein L34 (IPR000271)
Domains and repeats
None predicted.
Detailed signature matches
Protein sequence
>MCA_06412_1 MFTRYFANSLKTGLSMKTVSRSISFVSTNQSNALINFRTRMAPMTPTTLSNPLAVPNPILLPSIQDILEQKRWKARGNTY QPSTLKRKRVNGFLARLRTKGGKKVLARRKTKGRWYLSH
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome