Protein

MIA_00240_1

Length
475 amino acids

Browser: contig01:674475-675903+

Protein function

EGGNOG:0PI43PGUG_01300Transcription initiation factor TFIID
SGD closest match:S000003080TAF6Transcription initiation factor TFIID subunit 6
CGD closest match:CAL0000197010TAF60Taf60p

Protein alignments

%idAln lengthE-value
MCA_02770_171.705%5160.0MCA_02770_1
A0A0J9XD50_GEOCN71.429%4760.0Similar to Saccharomyces cerevisiae YGL112C TAF6 Subunit (60 kDa) of TFIID and SAGA complexes OS=Geotrichum candidum GN=BN980_GECA11s01319g PE=4 SV=1
A0A167DMW1_9ASCO61.042%4800.0Taf6p OS=Sugiyamaella lignohabitans GN=TAF6 PE=4 SV=1
UniRef50_A0A167DMW161.042%4800.0Taf6p n=6 Tax=Saccharomycetales TaxID=4892 RepID=A0A167DMW1_9ASCO
A0A060T286_BLAAD60.085%4710.0ARAD1C23364p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C23364g PE=4 SV=1
A0A1E3PTC0_9ASCO57.613%4860.0DUF1546-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45153 PE=4 SV=1
Q6CCZ2_YARLI53.061%4902.33e-180YALI0C05346p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C05346g PE=4 SV=1
A0A1D8PKJ2_CANAL45.543%5168.44e-161Taf60p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TAF60 PE=4 SV=1
A0A1E4TBW2_9ASCO46.818%4405.59e-143Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_58223 PE=4 SV=1
TAF6_YEAST47.356%4167.03e-136Transcription initiation factor TFIID subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF6 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1244

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 450 475

Detailed signature matches

  1. Domain IPR009072
    Histone-fold
    1. SSF47113 (Histone-fold)
  2. Domain IPR004823
    TATA box binding protein associated factor (TAF)
    1. SM00803 (TAF_cls)
    2. PF02969 (TAF)
  3. Domain IPR016024
    Armadillo-type fold
    1. SSF48371 (ARM repeat)
  4. Domain IPR011989
    Armadillo-like helical
    1. G3DSA:1.25.10.10
  5. Domain IPR011442
    TAF6, C-terminal HEAT repeat domain
    1. PF07571 (TAF6_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.20.10
  2. cd08050 (TAF6)

Protein sequence

>MIA_00240_1
MSQQSAASSIKYSHTLWSPSDTVRDVAEVLGISNLPDEVAKSLAMEVEYRIHEVVEQAVKFMRHSRRTLLTTADIGNAMR
VMNVEPLYGYETTRPLNYKEAMVGPGQTLYYIDDDDVDFEKIINQPLPKIPRATNFTAHWLAIEGVQPAIPQNPLPSEVK
AIPPQVRGSQVTHSVSALASDVEIKPLVKHVISKELQIYFDRVVEALLQEDADSESPSSLRNIALNSLRNDPGLHQLVPY
LVQFVQEQISQNLKSSLAIVSTMLEVIHAMLQNPNIFIEPYIHQIMPCLLTPLLSKRVGAESKPAAPDTLDETARESYAV
RDFAASLVSSISDKYSDVYYSLKPRVTRTLLKGFMDVNRSVPSWYGSIVGIRGLGPEVVRVVIVGNLKAWYHGILPRIPS
LADQKLLTMAIIDALRTLKKQVPTLLAAEDSDGSSAAVPLSEAEETQLKNLVGEKFYQILMMEKDALEIARGLLI

GO term prediction

Biological Process

GO:0006352 DNA-templated transcription, initiation
GO:0051090 regulation of sequence-specific DNA binding transcription factor activity

Molecular Function

GO:0005488 binding
GO:0046982 protein heterodimerization activity

Cellular Component

GO:0005634 nucleus