Protein
MIA_00204_1
Length
138 amino acids
Browser: contig01:576996-577518+
Protein function
| EGGNOG: | 0PQXU | SRB7 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors |
|---|---|---|---|
| SGD closest match: | S000002716 | SRB7 | Mediator of RNA polymerase II transcription subunit 21 |
| CGD closest match: | CAL0000199089 | SRB7 | Mediator of RNA polymerase II transcription subunit 21 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_00727_1 | 75.362% | 138 | 1.30e-64 | MCA_00727_1 |
| A0A0J9XBK0_GEOCN | 65.217% | 138 | 1.10e-49 | Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA09s00637g PE=4 SV=1 |
| UniRef50_A0A0J9XBK0 | 65.217% | 138 | 2.24e-46 | Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XBK0_GEOCN |
| A0A060T2C8_BLAAD | 53.676% | 136 | 1.76e-37 | ARAD1C24266p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C24266g PE=4 SV=1 |
| MED21_YARLI | 50.388% | 129 | 6.76e-31 | Mediator of RNA polymerase II transcription subunit 21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB7 PE=3 SV=1 |
| MED21_YEAST | 50.549% | 91 | 4.84e-28 | Mediator of RNA polymerase II transcription subunit 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB7 PE=1 SV=1 |
| A0A1E3PLP5_9ASCO | 47.525% | 101 | 3.17e-26 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50169 PE=4 SV=1 |
| A0A1E4TB89_9ASCO | 37.879% | 132 | 4.58e-20 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53311 PE=4 SV=1 |
| MED21_CANAL | 31.638% | 177 | 2.35e-15 | Mediator of RNA polymerase II transcription subunit 21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB7 PE=3 SV=1 |
| A0A167BWS0_9ASCO | 54.321% | 81 | 1.91e-15 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3716 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1067
Protein family membership
- Mediator complex, subunit Med21 (IPR021384)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Protein sequence
>MIA_00204_1 MSDRLTQLQVCVDQLLKQYYSALNYINNSHGFEPLGSEPPASDPQVNPVPKEKFHEDLTELARDIVLKSKQIDLLIDNLP GADSSEADQMARLRELETELESVENERQQVLVESSILLAKCDDLIIKVASDISEIQRS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.