Protein

MIA_00204_1

Length
138 amino acids


Browser: contig01:576996-577518+

Protein function

EGGNOG:0PQXUSRB7Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
SGD closest match:S000002716SRB7Mediator of RNA polymerase II transcription subunit 21
CGD closest match:CAL0000199089SRB7Mediator of RNA polymerase II transcription subunit 21

Protein alignments

%idAln lengthE-value
MCA_00727_175.362%1381.30e-64MCA_00727_1
A0A0J9XBK0_GEOCN65.217%1381.10e-49Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA09s00637g PE=4 SV=1
UniRef50_A0A0J9XBK065.217%1382.24e-46Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XBK0_GEOCN
A0A060T2C8_BLAAD53.676%1361.76e-37ARAD1C24266p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C24266g PE=4 SV=1
MED21_YARLI50.388%1296.76e-31Mediator of RNA polymerase II transcription subunit 21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB7 PE=3 SV=1
MED21_YEAST50.549%914.84e-28Mediator of RNA polymerase II transcription subunit 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB7 PE=1 SV=1
A0A1E3PLP5_9ASCO47.525%1013.17e-26Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50169 PE=4 SV=1
A0A1E4TB89_9ASCO37.879%1324.58e-20Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53311 PE=4 SV=1
MED21_CANAL31.638%1772.35e-15Mediator of RNA polymerase II transcription subunit 21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB7 PE=3 SV=1
A0A167BWS0_9ASCO54.321%811.91e-15Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3716 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1067

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF140718 (Mediator...)

Protein sequence

>MIA_00204_1
MSDRLTQLQVCVDQLLKQYYSALNYINNSHGFEPLGSEPPASDPQVNPVPKEKFHEDLTELARDIVLKSKQIDLLIDNLP
GADSSEADQMARLRELETELESVENERQQVLVESSILLAKCDDLIIKVASDISEIQRS

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.