Protein
MCA_00727_1
Length
138 amino acids
Gene name: SRB7
Description: Mediator of RNA polymerase II transcription subunit 21
Browser: contigA:2265076-2265604-
RNA-seq: read pairs 284, FPKM 25.2, percentile rank 47.8% (100% = highest expression)
Protein function
| Annotation: | SRB7 | Mediator of RNA polymerase II transcription subunit 21 | |
|---|---|---|---|
| KEGG: | K15152 | MED21 | mediator of RNA polymerase II transcription subunit 21 |
| EGGNOG: | 0PQXU | SRB7 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors |
| SGD closest match: | S000002716 | SRB7 | Mediator of RNA polymerase II transcription subunit 21 |
| CGD closest match: | CAL0000199089 | SRB7 | Mediator of RNA polymerase II transcription subunit 21 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00204_1 | 75.36% | 138 | 2e-71 | MIA_00204_1 |
| A0A0J9XBK0_GEOCN | 61.59% | 138 | 4e-55 | Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex OS=Geotrichum candidum GN=BN980_GECA09s00637g PE=4 SV=1 |
| UniRef50_A0A0J9XBK0 | 61.59% | 138 | 9e-52 | Similar to Saccharomyces cerevisiae YDR308C SRB7 Subunit of the RNA polymerase II mediator complex n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XBK0_GEOCN |
| A0A060T2C8_BLAAD | 52.94% | 136 | 5e-40 | ARAD1C24266p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C24266g PE=4 SV=1 |
| MED21_YARLI | 52.71% | 129 | 2e-35 | Mediator of RNA polymerase II transcription subunit 21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SRB7 PE=3 SV=1 |
| MED21_YEAST | 44.44% | 126 | 1e-29 | Mediator of RNA polymerase II transcription subunit 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRB7 PE=1 SV=1 |
| A0A1E3PLP5_9ASCO | 39.71% | 136 | 1e-28 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50169 PE=4 SV=1 |
| A0A1E4TB89_9ASCO | 41.91% | 136 | 5e-24 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53311 PE=4 SV=1 |
| MED21_CANAL | 33.90% | 177 | 4e-22 | Mediator of RNA polymerase II transcription subunit 21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SRB7 PE=3 SV=1 |
| A0A167BWS0_9ASCO | 44.44% | 81 | 1e-17 | Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3716 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1309
Protein family membership
- Mediator complex, subunit Med21 (IPR021384)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Protein sequence
>MCA_00727_1 MTDRLTQLQICVDQLLKQYYSAINYINNSHDFVPLGNEPKASDPQVAAVPSEKFNEDLKELARDIVVKSKQIDMLIDLLP GIGSTGKDQMDQIQQLQKELERVEFDRQQALVESSILLAKCDDLILKVAADVSEIQRS
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.