Protein
MIA_00095_1
Length
111 amino acids
Browser: contig01:249691-250165+
Protein function
EGGNOG: | 0PRBY | MGR2 | mitochondrial genome maintenance protein Mgr2 |
---|---|---|---|
SGD closest match: | S000006019 | MGR2 | Protein MGR2 |
CGD closest match: | CAL0000176138 | orf19.6062 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X9N3_GEOCN | 71.429% | 112 | 6.31e-55 | Similar to Saccharomyces cerevisiae YPL098C MGR2 Protein required for growth of cells lacking the mitochondrial genome OS=Geotrichum candidum GN=BN980_GECA06s01022g PE=4 SV=1 |
MCA_04328_1 | 76.316% | 114 | 1.14e-54 | MCA_04328_1 |
A0A060T8A3_BLAAD | 72.381% | 105 | 6.25e-52 | ARAD1D09438p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09438g PE=4 SV=1 |
Q6C043_YARLI | 61.538% | 104 | 6.97e-41 | YALI0F27929p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27929g PE=4 SV=1 |
A0A1E3PSM4_9ASCO | 56.897% | 116 | 2.26e-37 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20932 PE=4 SV=1 |
Q5ABA8_CANAL | 54.902% | 102 | 3.26e-35 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6062 PE=4 SV=1 |
UniRef50_B8M6X2 | 52.727% | 110 | 2.22e-29 | Mitochondrial genome maintenance protein Mgr2, putative n=44 Tax=leotiomyceta TaxID=716546 RepID=B8M6X2_TALSN |
MGR2_YEAST | 60.000% | 85 | 3.94e-32 | Protein MGR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGR2 PE=1 SV=1 |
A0A1E4T9I3_9ASCO | 60.000% | 70 | 3.22e-23 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_33001 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6697
Predicted cleavage: 66
Protein family membership
- Romo1/Mgr2 (IPR018450)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_00095_1 MPPVAQFPGMQAQQPSTWEKFKMGLFMGTAVGGCIGLLFGTVAVFQHGAGPNGIVRSIGQYMMGSAATFGLFMSIGSIIR SEEQAPRTPLAWQLAYARARIMSREDASKRL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.