Protein
MCA_04328_1
Length
114 amino acids
Gene name: MGR2
Description: mitochondrial genome maintenance protein Mgr2
Browser: contigC:2719463-2720026-
RNA-seq: read pairs 1147, FPKM 123.2, percentile rank 82.2% (100% = highest expression)
Protein function
Annotation: | MGR2 | mitochondrial genome maintenance protein Mgr2 | |
---|---|---|---|
EGGNOG: | 0PRBY | MGR2 | mitochondrial genome maintenance protein Mgr2 |
SGD closest match: | S000006019 | MGR2 | Protein MGR2 |
CGD closest match: | CAL0000176138 | orf19.6062 | Uncharacterized protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X9N3_GEOCN | 76.11% | 113 | 2e-49 | Similar to Saccharomyces cerevisiae YPL098C MGR2 Protein required for growth of cells lacking the mitochondrial genome OS=Geotrichum candidum GN=BN980_GECA06s01022g PE=4 SV=1 |
MIA_00095_1 | 71.05% | 114 | 2e-47 | MIA_00095_1 |
A0A060T8A3_BLAAD | 65.74% | 108 | 1e-40 | ARAD1D09438p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D09438g PE=4 SV=1 |
A0A1E3PSM4_9ASCO | 65.49% | 113 | 8e-32 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_20932 PE=4 SV=1 |
MGR2_YEAST | 63.01% | 73 | 3e-27 | Protein MGR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGR2 PE=1 SV=1 |
UniRef50_Q02889 | 63.01% | 73 | 7e-24 | Protein MGR2 n=81 Tax=Saccharomycetales TaxID=4892 RepID=MGR2_YEAST |
Q6C043_YARLI | 54.74% | 95 | 3e-27 | YALI0F27929p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F27929g PE=4 SV=1 |
Q5ABA8_CANAL | 56.16% | 73 | 1e-24 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6062 PE=4 SV=1 |
A0A1E4T9I3_9ASCO | 60.00% | 70 | 5e-22 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_33001 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.7715
Predicted cleavage: 82
Protein family membership
- Romo1/Mgr2 (IPR018450)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MCA_04328_1 MPPVAQMPGMHAQQPSAYEKFKMGLMMGTTVGACIGLLFGTVAVFQQGPGPNGIVRSIGRYMMGSAATFGLFMSIGSVIR SESSSLSPSNPAEWQMAYQRARIMSRKEAVSKNL
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.