Protein

MIA_00074_1

Length
173 amino acids

Browser: contig01:188587-189109-

Protein function

EGGNOG:0PJU3SEC11Catalytic component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum (By similarity)
SGD closest match:S000001461SEC11Signal peptidase complex catalytic subunit SEC11
CGD closest match:CAL0000184794SEC11Signal peptidase complex catalytic subunit SEC11

Protein alignments

%idAln lengthE-value
A0A0J9X906_GEOCN87.075%1474.50e-88Signal peptidase complex catalytic subunit SEC11 OS=Geotrichum candidum GN=BN980_GECA05s06258g PE=3 SV=1
A0A060TC93_BLAAD74.834%1511.41e-81Signal peptidase complex catalytic subunit SEC11 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39864g PE=3 SV=1
A0A1E3PH15_9ASCO68.590%1565.16e-74Signal peptidase complex catalytic subunit SEC11 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83610 PE=3 SV=1
SEC11_YARLI64.557%1582.48e-71Signal peptidase complex catalytic subunit SEC11 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC11 PE=3 SV=1
UniRef50_Q6CAG964.557%1585.75e-68Signal peptidase complex catalytic subunit SEC11 n=3 Tax=Saccharomycetales TaxID=4892 RepID=SEC11_YARLI
SEC11_CANAL65.772%1492.57e-67Signal peptidase complex catalytic subunit SEC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC11 PE=3 SV=1
MCA_03950_171.523%1511.47e-66MCA_03950_1
SEC11_YEAST59.333%1501.05e-61Signal peptidase complex catalytic subunit SEC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC11 PE=1 SV=2
A0A1E4TJB4_9ASCO58.333%1441.22e-53Signal peptidase complex catalytic subunit SEC11 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42456 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3770

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 173

Detailed signature matches

  1. Family IPR001733
    Peptidase S26B
    1. TIGR02228
    2. PR00728 (SIGNALPTASE)
  2. Domain IPR015927
    Peptidase S24/S26A/S26B/S26C
    1. SSF51306 (LexA/Sign...)
    2. PF00717 (Peptidase_S24)
  3. SITE IPR019756
    Peptidase S26A, signal peptidase I, serine active site
    1. PS00501 (SPASE_I_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:2.10.10...
  3. NON_CYTOPLASM... (N...)
  4. TRANSMEMBRANE (Tran...)
  5. cd06530 (S26_SPase_I)

Residue annotation

  1. Catalytic site cd0...

Protein sequence

>MIA_00074_1
MFNLPNISPRQALAQVLNLCLVVTTAFMFYKGLSVAANSPSPIVVVLSGSMEPAFQRGDILFLWNQEHRVSTGDIVVYNI
KDRDIPIVHRVLRQHASPKKQLLLTKGDNNALDDLDLYAHKQMYLDREAEVVGSVKGYIPIVGYITILLTENQNFKYALL
GLIGLSTLLQGDN

GO term prediction

Biological Process

GO:0006465 signal peptide processing

Molecular Function

GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity

Cellular Component

GO:0016020 membrane
GO:0016021 integral component of membrane