Protein

MIA_00033_1

Length
499 amino acids

Browser: contig01:76223-77723+

Protein function

EGGNOG:0PHG8PGUG_04995tRNA-specific 2-thiouridylase
SGD closest match:S000002191SLM3Mitochondrial tRNA-specific 2-thiouridylase 1
CGD closest match:CAL0000182034orf19.7245tRNA-5-taurinomethyluridine 2-sulfurtransferase

Protein alignments

%idAln lengthE-value
MCA_00337_150.620%4843.12e-168MCA_00337_1
A0A0J9X9L9_GEOCN53.846%4161.56e-152Similar to Saccharomyces cerevisiae YDL033C SLM3 tRNA-specific 2-thiouridylase, responsible for 2-thiolation of the wobble base of mitochondrial tRNAs OS=Geotrichum candidum GN=BN980_GECA06s01308g PE=4 SV=1
UniRef50_A0A0J9X9L953.846%4163.19e-149Similar to Saccharomyces cerevisiae YDL033C SLM3 tRNA-specific 2-thiouridylase, responsible for 2-thiolation of the wobble base of mitochondrial tRNAs n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X9L9_GEOCN
A0A060T1T4_BLAAD54.569%3941.75e-146ARAD1C18722p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C18722g PE=4 SV=1
Q6C0F9_YARLI48.223%3941.04e-132YALI0F25069p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F25069g PE=4 SV=1
A0A1D8PFW8_CANAL48.387%4031.69e-130tRNA-5-taurinomethyluridine 2-sulfurtransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7245 PE=4 SV=1
A0A161HIW6_9ASCO48.878%4011.15e-129Slm3p OS=Sugiyamaella lignohabitans GN=SLM3 PE=4 SV=1
MTU1_YEAST43.204%4122.74e-110Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM3 PE=1 SV=1
A0A1E3PSC3_9ASCO54.730%2962.06e-1105-methylaminomethyl-2-thiouridylate-methyltransferase (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_80985 PE=4 SV=1
A0A1E4TAH0_9ASCO40.665%3911.21e-89Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3368 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9900
Predicted cleavage: 48

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 499

Detailed signature matches

  1. Family IPR004506
    tRNA-specific 2-thiouridylase
    1. TIGR00420
    2. cd01998 (tRNA_Me_trans)
  2. Domain IPR014729
    Rossmann-like alpha/beta/alpha sandwich fold
    1. G3DSA:3.40.50...
  3. Domain IPR023382
    Adenine nucleotide alpha hydrolase-like domains
    1. G3DSA:2.30.30...
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.40.30.10
  2. PF03054 (tRNA_Me_trans)
  3. SSF52402 (Adenine n...)
  4. mobidb-lite (disord...)

Residue annotation

  1. Ligand Binding Sit...

Protein sequence

>MIA_00033_1
MNRKILPLLLSNVRNTRPLARSSISLLFKAPWHATHPRAISINTHTDNSPLPEQINNTRTKQQTTNKNTPAEDLTLLKDP
LAPLLLPSADSDLYEDRLPGPDDDIWVGLSSGVDSSTSIALLKALTERQQQASGTAGTEKVRGIFMANWSSTAKCAEADW
ADVQRVCKTVGVDCERVSFEREYWQEVFEPMIEMYRQGMTPNPDVGCNRHIKFGSLIKHLENKYKTDSSNKKWWLATGHY
ARIATHKPSGETHLLRPSHLPKDQSYYLSSISAEVFPHILFPLAHYTKPQVRQLAKHLFHLSTAEKPDSQGLCFVSQEHN
TFRNFLDEYLPPAPGNFVIKRLADDGTEIKTVVGQHKGIWHATVGQKSGFALPQGRPETKGVWYVQAKDPESREITLVRG
NNHPALFSKAVQVKNFDFLGEALPKHLTSLHVQYRSLQAPEPVKSFDCKQLSNSYSLAIEFESPRRAIAPGQYLVLYSGD
RVLGSGIITSTTPIAKPYS

GO term prediction

Biological Process

GO:0008033 tRNA processing

Molecular Function

GO:0016740 transferase activity
GO:0016783 sulfurtransferase activity

Cellular Component

None predicted.