MIA_00023_1

Browser: contig01:49159-49613-

Protein function

EGGNOG:	0PSY1	MZM1	Assembly factor required for Rieske Fe-S protein RIP1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane. Modulates the mitochondrial matrix zinc pool (By similarity)
SGD closest match:	S000002901	MZM1	Mitochondrial zinc maintenance protein 1, mitochondrial
CGD closest match:	CAL0000189259	MZM1	Mitochondrial zinc maintenance protein 1, mitochondrial

Protein alignments

	%id	Aln length	E-value
MCA_04611_1	47.619%	126	7.42e-32	MCA_04611_1
A0A0J9XBY1_GEOCN	44.355%	124	6.84e-29	Similar to Saccharomyces cerevisiae YDR493W MZM1 Mitochondrial matrix protein with a role in maintaining the labile mitochondrial zinc pool OS=Geotrichum candidum GN=BN980_GECA07s03376g PE=3 SV=1
UniRef50_A0A0J9XBY1	44.355%	124	1.40e-25	Similar to Saccharomyces cerevisiae YDR493W MZM1 Mitochondrial matrix protein with a role in maintaining the labile mitochondrial zinc pool n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBY1_GEOCN
A0A060T3A8_BLAAD	43.878%	98	2.10e-19	ARAD1A08162p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08162g PE=4 SV=1
A0A1E4TH94_9ASCO	36.066%	122	9.60e-17	Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_116740 PE=4 SV=1
MZM1_CANAL	37.113%	97	3.79e-16	Mitochondrial zinc maintenance protein 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MZM1 PE=3 SV=1
MZM1_YEAST	36.923%	130	1.91e-15	Mitochondrial zinc maintenance protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MZM1 PE=1 SV=1
A0A161HFN3_9ASCO	39.241%	79	6.65e-15	Mzm1p OS=Sugiyamaella lignohabitans GN=MZM1 PE=3 SV=1
MZM1_YARLI	37.624%	101	1.73e-13	Mitochondrial zinc maintenance protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MZM1 PE=3 SV=1
A0A1E3PHM9_9ASCO	30.769%	91	7.05e-07	Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51524 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8395
Predicted cleavage: 22

Protein family membership

Domains and repeats

Detailed signature matches

Protein sequence

>MIA_00023_1
MSQSTAVLQTYRNLLRSCKHLFSNDVPRLTAAVAEIRTRYHADKSLTSSDEIAEKLQLAKDVNTILRQNVVQGVQDTKDP
NKYHLKIHNETELGYNDSVKEPKITPPKPITGKSKRAPTNLSSRCGGQ

GO term prediction