Protein
MCA_04611_1
Length
133 amino acids
Gene name: MZM1
Description: Mitochondrial zinc maintenance protein 1, mitochondrial
Browser: contigC:3507071-3507572-
RNA-seq: read pairs 1094, FPKM 100.9, percentile rank 78.8% (100% = highest expression)
Protein function
| Annotation: | MZM1 | Mitochondrial zinc maintenance protein 1, mitochondrial | |
|---|---|---|---|
| KEGG: | K18170 | LYRM7 | complex III assembly factor LYRM7 |
| EGGNOG: | 0PSY1 | MZM1 | Assembly factor required for Rieske Fe-S protein RIP1 incorporation into the cytochrome b-c1 (CIII) complex. Functions as a chaperone, binding to this subunit within the mitochondrial matrix and stabilizing it prior to its translocation and insertion into the late CIII dimeric intermediate within the mitochondrial inner membrane. Modulates the mitochondrial matrix zinc pool (By similarity) |
| SGD closest match: | S000002901 | MZM1 | Mitochondrial zinc maintenance protein 1, mitochondrial |
| CGD closest match: | CAL0000189259 | MZM1 | Mitochondrial zinc maintenance protein 1, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XBY1_GEOCN | 58.33% | 108 | 6e-38 | Similar to Saccharomyces cerevisiae YDR493W MZM1 Mitochondrial matrix protein with a role in maintaining the labile mitochondrial zinc pool OS=Geotrichum candidum GN=BN980_GECA07s03376g PE=3 SV=1 |
| UniRef50_A0A0J9XBY1 | 58.33% | 108 | 1e-34 | Similar to Saccharomyces cerevisiae YDR493W MZM1 Mitochondrial matrix protein with a role in maintaining the labile mitochondrial zinc pool n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBY1_GEOCN |
| MIA_00023_1 | 54.84% | 93 | 5e-30 | MIA_00023_1 |
| A0A060T3A8_BLAAD | 34.95% | 103 | 9e-12 | ARAD1A08162p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08162g PE=4 SV=1 |
| A0A1E4TH94_9ASCO | 34.86% | 109 | 9e-12 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_116740 PE=4 SV=1 |
| A0A161HFN3_9ASCO | 38.81% | 67 | 2e-11 | Mzm1p OS=Sugiyamaella lignohabitans GN=MZM1 PE=3 SV=1 |
| MZM1_YARLI | 31.58% | 95 | 2e-09 | Mitochondrial zinc maintenance protein 1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MZM1 PE=3 SV=1 |
| MZM1_YEAST | 36.36% | 110 | 3e-09 | Mitochondrial zinc maintenance protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MZM1 PE=1 SV=1 |
| MZM1_CANAL | 30.70% | 114 | 2e-08 | Mitochondrial zinc maintenance protein 1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MZM1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9446
Predicted cleavage: 25
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04611_1 MSTPAALPKPLQAYRMIIRSCKNLFVGDEMRLQAAMKELRRQYEECRDLKDPEAINEKLQYAKDIDIILRKNVVQGVQSE KRPGTYELRITEETELGYNDDIKKNSNRKTTNLANTGRNISCCGGSSNNSAQN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.