Protein
MIA_00021_1
Length
278 amino acids
Browser: contig01:45771-46608-
Protein function
| EGGNOG: | 0PPJC | MED7 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
|---|---|---|---|
| SGD closest match: | S000005495 | MED7 | Mediator of RNA polymerase II transcription subunit 7 |
| CGD closest match: | CAL0000180608 | MED7 | Mediator of RNA polymerase II transcription subunit 7 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A167FG55_9ASCO | 46.842% | 190 | 6.31e-39 | Mediator of RNA polymerase II transcription subunit 7 OS=Sugiyamaella lignohabitans GN=MED7 PE=3 SV=1 |
| A0A0J9XBY7_GEOCN | 37.900% | 219 | 5.15e-39 | Mediator of RNA polymerase II transcription subunit 7 OS=Geotrichum candidum GN=BN980_GECA07s03431g PE=3 SV=1 |
| UniRef50_A0A0J9XBY7 | 37.900% | 219 | 1.05e-35 | Mediator of RNA polymerase II transcription subunit 7 n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBY7_GEOCN |
| MED7_YARLI | 41.395% | 215 | 1.32e-35 | Mediator of RNA polymerase II transcription subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED7 PE=3 SV=1 |
| A0A060TCB2_BLAAD | 41.553% | 219 | 1.17e-32 | Mediator of RNA polymerase II transcription subunit 7 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40194g PE=3 SV=1 |
| MCA_05310_1 | 36.842% | 209 | 3.57e-26 | MCA_05310_1 |
| A0A1E3PRT9_9ASCO | 31.492% | 181 | 2.43e-27 | Mediator of RNA polymerase II transcription subunit 7 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81069 PE=3 SV=1 |
| A0A1E4TLX9_9ASCO | 37.368% | 190 | 7.95e-23 | Mediator of RNA polymerase II transcription subunit 7 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1369 PE=3 SV=1 |
| MED7_YEAST | 38.158% | 152 | 1.52e-19 | Mediator of RNA polymerase II transcription subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED7 PE=1 SV=1 |
| MED7_CANAL | 33.133% | 166 | 1.07e-16 | Mediator of RNA polymerase II transcription subunit 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED7 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0071
Protein family membership
- Mediator complex, subunit Med7 (IPR009244)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
SSF140718 (Mediator...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_00021_1 MSDPPQNDLLATVPPPPAYYKYFTDENVARKKEAGKGPVEFPLTLLDPPPPPEAPGTYRSFGNVWQTDNKLMSLKEVGIS QLYADNDDGSNNNNDQGKTDSLAQDTAGAVPRRAQELKKLIATLLVKFVELAGVMSVQPEGFPGLVEEMRVVLINVHHLL NEYRPHQSRESLLQLLEEQIAAKREEIGKLRESNDEIRDRIASLSTRFRRLLAENPKKEELGDAEEMGRPKQQLPEEMAG NNGGVVTAGGGGGHKHKALSARTLDQLSWSLLDYARPA
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex