Protein
MCA_05310_1
Length
299 amino acids
Gene name: MED7
Description: Mediator of RNA polymerase II transcription subunit 7
Browser: contigD:973313-974213+
RNA-seq: read pairs 530, FPKM 21.8, percentile rank 43.7% (100% = highest expression)
Protein function
| Annotation: | MED7 | Mediator of RNA polymerase II transcription subunit 7 | |
|---|---|---|---|
| KEGG: | K15148 | MED7 | mediator of RNA polymerase II transcription subunit 7 |
| EGGNOG: | 0PPJC | MED7 | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity) |
| SGD closest match: | S000005495 | MED7 | Mediator of RNA polymerase II transcription subunit 7 |
| CGD closest match: | CAL0000180608 | MED7 | Mediator of RNA polymerase II transcription subunit 7 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MED7_YARLI | 38.21% | 212 | 4e-32 | Mediator of RNA polymerase II transcription subunit 7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED7 PE=3 SV=1 |
| UniRef50_Q6CE96 | 38.21% | 212 | 9e-29 | Mediator of RNA polymerase II transcription subunit 7 n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=MED7_YARLI |
| A0A060TCB2_BLAAD | 37.50% | 208 | 1e-28 | Mediator of RNA polymerase II transcription subunit 7 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D40194g PE=3 SV=1 |
| A0A0J9XBY7_GEOCN | 37.38% | 214 | 6e-28 | Mediator of RNA polymerase II transcription subunit 7 OS=Geotrichum candidum GN=BN980_GECA07s03431g PE=3 SV=1 |
| A0A167FG55_9ASCO | 34.87% | 261 | 1e-27 | Mediator of RNA polymerase II transcription subunit 7 OS=Sugiyamaella lignohabitans GN=MED7 PE=3 SV=1 |
| MIA_00021_1 | 36.84% | 209 | 2e-25 | MIA_00021_1 |
| MED7_YEAST | 35.82% | 201 | 4e-24 | Mediator of RNA polymerase II transcription subunit 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED7 PE=1 SV=1 |
| A0A1E4TLX9_9ASCO | 31.22% | 221 | 1e-18 | Mediator of RNA polymerase II transcription subunit 7 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1369 PE=3 SV=1 |
| MED7_CANAL | 32.90% | 231 | 2e-16 | Mediator of RNA polymerase II transcription subunit 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED7 PE=3 SV=1 |
| A0A1E3PRT9_9ASCO | 32.76% | 174 | 1e-12 | Mediator of RNA polymerase II transcription subunit 7 (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81069 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0042
Protein family membership
- Mediator complex, subunit Med7 (IPR009244)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
SSF140718 (Mediator...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05310_1 MENLSTTVPFPPFYYKFFTDENVAKVRQKKKEHEASNSKEELKLEYPLNLLVPPEPPKEGRYSSYGSSWNVEEELVNLEE LGIPIIYDQGQQNGKDQSTNPTSSETTVSNSNDGTKIRQLKKLKNSLLIQFLQLLACLSTDPAKFAPYTTNIQNLLINMH HLLNEYRPHQSREMLITLMKEEIERKNQEIQKIKETNKEIHEKISNLAKRQQQQELQNGSVSRGGGGVAETGPGNNLQQN TTSADMNAKSKNSNSPQTQNETQTNAQDENENEEEIVAAVASKLTSKSIDLLSWSLVLD
GO term prediction
Biological Process
GO:0006357 regulation of transcription from RNA polymerase II promoter
Molecular Function
GO:0001104 RNA polymerase II transcription cofactor activity
Cellular Component
GO:0016592 mediator complex