Protein
MIA_00016_1
Length
222 amino acids
Browser: contig01:38290-38959+
Protein function
| EGGNOG: | 0PMGW | ATP23 | Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane- embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity) |
|---|---|---|---|
| SGD closest match: | S000005303 | ATP23 | Mitochondrial inner membrane protease ATP23 |
| CGD closest match: | CAL0000186668 | ATP23 | Mitochondrial inner membrane protease ATP23 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05641_1 | 74.648% | 213 | 4.76e-123 | MCA_05641_1 |
| A0A0J9XBK8_GEOCN | 71.171% | 222 | 4.77e-122 | Mitochondrial inner membrane protease ATP23 OS=Geotrichum candidum GN=BN980_GECA07s00736g PE=3 SV=1 |
| A0A167DJY9_9ASCO | 69.484% | 213 | 1.80e-117 | Mitochondrial inner membrane protease ATP23 OS=Sugiyamaella lignohabitans GN=ATP23 PE=3 SV=1 |
| ATP23_YARLI | 55.963% | 218 | 2.83e-96 | Mitochondrial inner membrane protease ATP23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP23 PE=3 SV=1 |
| UniRef50_Q6C253 | 55.963% | 218 | 6.56e-93 | Mitochondrial inner membrane protease ATP23 n=4 Tax=Saccharomycetales TaxID=4892 RepID=ATP23_YARLI |
| A0A060TCC2_BLAAD | 58.986% | 217 | 6.66e-96 | Mitochondrial inner membrane protease ATP23 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B15532g PE=3 SV=1 |
| A0A1E3PJ86_9ASCO | 55.399% | 213 | 5.38e-90 | Mitochondrial inner membrane protease ATP23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25152 PE=3 SV=1 |
| A0A1E4TK25_9ASCO | 57.635% | 203 | 1.09e-89 | Mitochondrial inner membrane protease ATP23 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147498 PE=3 SV=1 |
| ATP23_YEAST | 50.000% | 226 | 1.80e-85 | Mitochondrial inner membrane protease ATP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP23 PE=1 SV=2 |
| ATP23_CANAL | 50.000% | 232 | 8.72e-80 | Mitochondrial inner membrane protease ATP23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP23 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2140
Protein family membership
- Peptidase M76, ATP23 (IPR019165)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09768 (Peptidase_M76)
-
Protein sequence
>MIA_00016_1 MSQDNTPSNQSFFATWSKKFSYLAGSMSPEEEEAFKAQLAIEKTQRECARCEDYKAWMMAYSPSVRFMLEQIARVGGNVS AKNIVCDECDEFKSGGFHPELGILLCQNRIYSKWHLEDTLTHELVHAYDHCKFDVDWANLRHHACSEIRASSLSGECRMM NQIVKNKIFKFSKGHQDCVRRRATLSVKSNPACKSDEEAAKVVNQVFESCFNDTRPFEEIYR
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004222 metalloendopeptidase activity
Cellular Component
None predicted.