Protein
MCA_05641_1
Length
240 amino acids
Gene name: ATP23
Description: Mitochondrial inner membrane protease ATP23
Browser: contigD:1900963-1901774+
RNA-seq: read pairs 918, FPKM 47.1, percentile rank 64.0% (100% = highest expression)
Protein function
| Annotation: | ATP23 | Mitochondrial inner membrane protease ATP23 | |
|---|---|---|---|
| KEGG: | K18156 | ATP23 | mitochondrial inner membrane protease ATP23 [EC:3.4.24.-] |
| EGGNOG: | 0PMGW | ATP23 | Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane- embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity) |
| SGD closest match: | S000005303 | ATP23 | Mitochondrial inner membrane protease ATP23 |
| CGD closest match: | CAL0000186668 | ATP23 | Mitochondrial inner membrane protease ATP23 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_00016_1 | 74.65% | 213 | 3e-121 | MIA_00016_1 |
| A0A167DJY9_9ASCO | 65.88% | 211 | 5e-110 | Mitochondrial inner membrane protease ATP23 OS=Sugiyamaella lignohabitans GN=ATP23 PE=3 SV=1 |
| A0A0J9XBK8_GEOCN | 63.68% | 223 | 2e-107 | Mitochondrial inner membrane protease ATP23 OS=Geotrichum candidum GN=BN980_GECA07s00736g PE=3 SV=1 |
| A0A060TCC2_BLAAD | 55.51% | 254 | 3e-95 | Mitochondrial inner membrane protease ATP23 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B15532g PE=3 SV=1 |
| A0A1E3PJ86_9ASCO | 59.24% | 211 | 5e-94 | Mitochondrial inner membrane protease ATP23 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25152 PE=3 SV=1 |
| ATP23_YARLI | 53.91% | 230 | 1e-88 | Mitochondrial inner membrane protease ATP23 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATP23 PE=3 SV=1 |
| UniRef50_Q6C253 | 53.91% | 230 | 2e-85 | Mitochondrial inner membrane protease ATP23 n=4 Tax=Saccharomycetales TaxID=4892 RepID=ATP23_YARLI |
| A0A1E4TK25_9ASCO | 56.52% | 207 | 2e-86 | Mitochondrial inner membrane protease ATP23 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147498 PE=3 SV=1 |
| ATP23_YEAST | 48.89% | 225 | 7e-79 | Mitochondrial inner membrane protease ATP23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP23 PE=1 SV=2 |
| ATP23_CANAL | 50.00% | 232 | 5e-76 | Mitochondrial inner membrane protease ATP23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP23 PE=3 SV=2 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2827
Protein family membership
- Peptidase M76, ATP23 (IPR019165)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF09768 (Peptidase_M76)
-
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_05641_1 MSSDSIDNSKASDAPIISPAQESTQQDGFFTTWSKKFQYLTNTGMSEEEREKFKQKLEADKNDRECKRCEEYKTWMLNYS PSVRFMMDQIHRIGGNISSQNIVCAPCDELKSGGFHPELGILLCQNRFNSKWHLEDTLTHELVHAYDHCKFNVDWMDLRH HACSEIRASSLSGECRMMNQIVKNGIWKFTKGHQACVKRRAALSVLNHPKCKDKQMADEIVNQVFESCFNDTRPFEEIYR
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004222 metalloendopeptidase activity
Cellular Component
None predicted.