Protein

MIA_00014_1

Length
75 amino acids


Browser: contig01:36648-36934+

Protein alignments

%idAln lengthE-value
A0A0J9XAB8_GEOCN64.384%736.12e-34NB5M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA07s00719g PE=4 SV=1
UniRef50_A0A0J9XAB864.384%731.25e-30NB5M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XAB8_GEOCN
MCA_05602_165.278%721.15e-33MCA_05602_1
A0A060T1G4_BLAAD55.263%764.07e-24ARAD1A00418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00418g PE=4 SV=1
B5RSK9_YARLI37.313%675.40e-11YALI0F06061p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06061g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0121

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_00014_1
MAGHGPSTVNHDAAIERWYAMRENLADNFKYTRKSGRFVFLALGLVPAVMIYGAYKYAGQLDFVAKRRNESIWRK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.