Protein

MCA_05602_1

Length
78 amino acids


Browser: contigD:1776893-1777283+

RNA-seq: read pairs 4759, FPKM 744.3, percentile rank 95.7% (100% = highest expression)

Protein alignments

%idAln lengthE-value
MIA_00014_165.28%722e-32MIA_00014_1
A0A0J9XAB8_GEOCN56.41%785e-31NB5M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA07s00719g PE=4 SV=1
UniRef50_A0A0J9XAB856.41%781e-27NB5M subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XAB8_GEOCN
A0A060T1G4_BLAAD48.68%762e-21ARAD1A00418p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00418g PE=4 SV=1
B5RSK9_YARLI34.33%674e-09YALI0F06061p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F06061g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0026

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MCA_05602_1
MAGHGHGPSPVNTDREIERFYQMRENMADHFKFTRKSGRFVFLSLVAVPTILLIGAYKFGGQIDMAGRRRTESIWRSH

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.