Protein

MCA_06403_1

Length
491 amino acids


Gene name: SSN3

Description: Serine/threonine protein kinase Ssn3; cyclin-dependent protein kinase

Browser: contigD:4106567-4108043-

RNA-seq: read pairs 995, FPKM 25.0, percentile rank 47.6% (100% = highest expression)

Protein function

Annotation:SSN3Serine/threonine protein kinase Ssn3; cyclin-dependent protein kinase
KEGG:K02208CDK8_11 cyclin-dependent kinase 8/11 [EC:2.7.11.22 2.7.11.23]
EGGNOG:0PGXBSSN3Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II- dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. The SRB8-11 complex phosphorylates the C-terminal domain (CTD) of the largest subunit of RNA polymerase II
SGD closest match:S000005963SSN3Meiotic mRNA stability protein kinase SSN3
CGD closest match:CAL0000183529SSN3Serine/threonine-protein kinase SSN3

Protein alignments

%idAln lengthE-value
MIA_05462_173.15%4060.0MIA_05462_1
A0A060TIS6_BLAAD72.26%3930.0ARAD1D48994p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48994g PE=4 SV=1
A0A0J9X5B1_GEOCN71.43%3990.0Similar to Saccharomyces cerevisiae YPL042C SSN3 Cyclin-dependent protein kinase, component of RNA polymerase II holoenzyme OS=Geotrichum candidum GN=BN980_GECA03s01165g PE=4 SV=1
A0A161HX00_9ASCO70.63%3950.0Cyclin-dependent serine/threonine protein kinase SSN3 OS=Sugiyamaella lignohabitans GN=SSN3 PE=4 SV=1
UniRef50_A0A161HX0070.63%3950.0Cyclin-dependent serine/threonine protein kinase SSN3 n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A161HX00_9ASCO
SSN3_YARLI68.21%3900.0Serine/threonine-protein kinase SSN3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SSN3 PE=3 SV=1
A0A1E4TLJ8_9ASCO59.28%3881e-161Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147630 PE=4 SV=1
SSN3_CANAL53.81%4202e-145Serine/threonine-protein kinase SSN3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSN3 PE=3 SV=2
SSN3_YEAST60.37%3281e-142Meiotic mRNA stability protein kinase SSN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSN3 PE=1 SV=3
A0A1E3PQA7_9ASCO59.08%3473e-144Kinase-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82050 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0555

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 450 491

Detailed signature matches

    1. SSF56112 (Protein k...)
    1. PS50011 (PROTEIN_KI...)
    2. SM00220 (serkin_6)
    3. PF00069 (Pkinase)
    1. PS00108 (PROTEIN_KI...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd07842 (STKc_CDK8_...)
  2. mobidb-lite (disord...)

Residue annotation

  1. ATP binding site c...
  2. active site cd07842
  3. CDK/cyclin interfa...
  4. polypeptide substr...
  5. activation loop (A...

Protein sequence

>MCA_06403_1
MFNNTNSNSSNSNSGNINYNITSDDRINSSSQRYNSNNNHGPVYTKARFYPPPQVIPHLNSSSHQLIHQPASQNRNSNLQ
QGQQHISSHQRQSQGFHKKPLPSMVSNPLANFKSRKDRSRRRLLDSYEILGYIAAGTYGKVYKAKSKHQENGDKLYAIKK
FKADKEGEVSHYTGISQSACREMALCKELSHQNVVNLAEIILEDKSIYMVFDYAEHDLLQLIHYHTHPDRKAIPESTVKS
ILWQILNGVSYLHQNWVLHRDLKPANIMLSVDGVVKIGDLGLARLFSDPLQSFFTGDKVIVTIWYRAPELLLGGRHYTPA
IDLWAVGCIFAELLALKPIFKGEEAKMDNKKNVPFQRNQFQKVVDILGMPSTENWPTLSKYPEASQLNLIRRCRPSLESW
YQSQIFGASSQNAFDLLNRLLTYDPAKRITAHDALVDPYFLDNPKVQKNVFQGQCYEYPNRRISNDDNDIKCQTKRPAAN
DDNLHPRKKQK

GO term prediction

Biological Process

GO:0006468 protein phosphorylation

Molecular Function

GO:0004672 protein kinase activity
GO:0005524 ATP binding

Cellular Component

None predicted.