Protein

MCA_06401_1

Length
228 amino acids

Browser: contigD:4102426-4103183+

RNA-seq: read pairs 12391, FPKM 668.6, percentile rank 95.4% (100% = highest expression)

Protein function

KEGG:K00275pdxH pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
EGGNOG:0PK76PGUG_04223pyridoxamine 5'-phosphate oxidase
SGD closest match:S000000239PDX3Pyridoxamine 5'-phosphate oxidase
CGD closest match:CAL0000195497PDX3Pyridoxamine-phosphate oxidase

Protein alignments

%idAln lengthE-value
MIA_04249_175.45%2241e-117MIA_04249_1
A0A0J9XK01_GEOCN67.26%2262e-107Similar to Saccharomyces cerevisiae YBR035C PDX3 Pyridoxine (Pyridoxamine) phosphate oxidase OS=Geotrichum candidum GN=BN980_GECA20s01715g PE=3 SV=1
A0A060THL3_BLAAD64.49%2141e-94ARAD1D39204p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D39204g PE=4 SV=1
Q6C946_YARLI58.15%2275e-86YALI0D14322p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D14322g PE=3 SV=1
PDX3_YEAST56.52%2303e-85Pyridoxamine 5'-phosphate oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDX3 PE=1 SV=1
UniRef50_P3807556.52%2307e-82Pyridoxamine 5'-phosphate oxidase n=44 Tax=Ascomycota TaxID=4890 RepID=PDX3_YEAST
A0A1E3PHQ8_9ASCO60.09%2282e-84Pyridoxamine 5'-phosphate oxidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51537 PE=3 SV=1
A0A1D8PSU2_CANAL53.91%2305e-80Pyridoxamine-phosphate oxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PDX3 PE=4 SV=1
A0A1E4TC54_9ASCO52.70%2228e-74Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3959 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0135

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 228

Detailed signature matches

  1. Family IPR000659
    Pyridoxamine 5'-phosphate oxidase
    1. PIRSF000190 (Pyd_am...)
    2. TIGR00558
    3. MF_01629 (PdxH)
  2. Domain IPR012349
    FMN-binding split barrel
    1. SSF50475 (FMN-bindi...)
    2. G3DSA:2.30.11...
  3. Domain IPR011576
    Pyridoxamine 5'-phosphate oxidase, putative
    1. PF01243 (Putative_P...)
  4. Domain IPR019576
    Pyridoxine 5'-phosphate oxidase, dimerisation, C-terminal
    1. PF10590 (PNP_phzG_C)
  5. SITE IPR019740
    Pyridoxamine 5'-phosphate oxidase, conserved site
    1. PS01064 (PYRIDOX_OX...)

Protein sequence

>MCA_06401_1
MTNTSTTKEDAIIFAPETHQYGKSSLDREDLENDPTTLFLKWFKEAQSASKLPEAVTLSTARLPSGRVSSRVVLFKELDK
DGSVVIYSNWGTSKKSKDVKSNPHAAITFFWPELERQVRVEGVTEFLSNEESQIYFNTRPKESRIGAWASPQSQPVKDKE
ELERLVKEREEEFKDSDIVPCPPHWGGLRIKPLEWEFWQGRPSRIHDRFSYTRESPDKAEWEINRLGP

GO term prediction

Biological Process

GO:0008615 pyridoxine biosynthetic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004733 pyridoxamine-phosphate oxidase activity
GO:0010181 FMN binding
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors
GO:0048037 cofactor binding

Cellular Component

None predicted.