Protein

MCA_06283_1

Length
193 amino acids

Browser: contigD:3758841-3759910+

RNA-seq: read pairs 1079, FPKM 68.7, percentile rank 72.2% (100% = highest expression)

Protein function

KEGG:K04392RAC1 Ras-related C3 botulinum toxin substrate 1
EGGNOG:0PIRJRAC1cell division control protein 42
SGD closest match:S000004219CDC42Cell division control protein 42
CGD closest match:CAL0000192612CDC42Cell division control protein 42 homolog

Protein alignments

%idAln lengthE-value
MIA_06406_196.11%1803e-130MIA_06406_1
A0A0J9XAH6_GEOCN93.26%1788e-126Similar to Saccharomyces cerevisiae YLR229C CDC42 Small rho-like GTPase OS=Geotrichum candidum GN=BN980_GECA07s00087g PE=3 SV=1
A0A060TBT1_BLAAD88.95%1819e-123ARAD1D34452p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D34452g PE=3 SV=1
A0A167F9W5_9ASCO87.15%1795e-120Rho family GTPase CDC42 OS=Sugiyamaella lignohabitans GN=CDC42 PE=3 SV=1
F2Z658_YARLI87.15%1792e-119YALI0E25845p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E25845g PE=3 SV=1
A0A1E3PDI1_9ASCO86.03%1792e-117Structural basis of promiscuous guanine nucleotide exchange By the T-cell essential Vav1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84150 PE=3 SV=1
UniRef50_P6300083.80%1794e-109Ras-related C3 botulinum toxin substrate 1 n=1427 Tax=Opisthokonta TaxID=33154 RepID=RAC1_HUMAN
A0A1E4TBM5_9ASCO74.48%1923e-104Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53613 PE=3 SV=1
CDC42_YEAST67.04%1792e-91Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2
CDC42_CANAL66.48%1792e-89Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1253

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 193

Detailed signature matches

  1. Family IPR001806
    Small GTPase superfamily
    1. PF00071 (Ras)
  2. Family IPR003578
    Small GTPase superfamily, Rho type
    1. PS51420 (RHO)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70...
  2. G3DSA:3.40.50...
  3. PR00449 (RASTRNSFRMNG)
  4. SM00173 (ras_sub_4)
  5. SM00174 (rho_sub_3)
  6. SM00175 (rab_sub_5)
  7. cd01871 (Rac1_like)

Residue annotation

  1. GEF (guanine nucle...
  2. G1 box cd01871
  3. GTP/Mg2+ binding s...
  4. p67PhoxTPR effecto...
  5. Switch I region cd...
  6. GAP (GTPase-activa...
  7. G2 box cd01871
  8. Arfaptin/Por effec...
  9. GDI (guanine nucle...
  10. G3 box cd01871
  11. Switch II region c...
  12. G4 box cd01871
  13. G5 box cd01871

Protein sequence

>MCA_06283_1
MRSIKCVVTGDGAVGKTCMLISYTTNAFPGEYIPTVFDNYSANVMVDNKPINLGLWDTAGQEDYDRLRPLSYPQTGVFLI
CFSLVSPPSFENVKTKWYPEVSHHAPDTPIILVGTKLDLREDRETVEKLKERRQTPITYAQGLQCAKEIGAVKYLECSAL
TQKGLKAVFDEAIHVALTPQTNKKKKQKKCLIL

GO term prediction

Biological Process

GO:0007264 small GTPase mediated signal transduction

Molecular Function

GO:0003924 GTPase activity
GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular