Protein
MCA_06265_1
Length
64 amino acids
Browser: contigD:3718112-3718362+
RNA-seq: read pairs 7, FPKM 1.3, percentile rank 10.1% (100% = highest expression)
Protein function
| SGD closest match: | S000005929 | CHL1 | ATP-dependent DNA helicase CHL1 |
|---|---|---|---|
| CGD closest match: | CAL0000177726 | CHL1 | ATP-dependent DNA helicase CHL1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| UniRef50_UPI000866AC0D | 76.92% | 39 | 6e-14 | UPI000866AC0D related cluster n=1 Tax=unknown TaxID= RepID=UPI000866AC0D |
| A0A0J9XED3_GEOCN | 66.67% | 48 | 3e-15 | Similar to Saccharomyces cerevisiae YPL008W CHL1 Probable DNA helicase involved in sister-chromatid cohesion and genome integrity OS=Geotrichum candidum GN=BN980_GECA12s00142g PE=4 SV=1 |
| MIA_05190_1 | 61.70% | 47 | 6e-14 | MIA_05190_1 |
| CHL1_YARLI | 60.00% | 45 | 7e-13 | ATP-dependent DNA helicase CHL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CHL1 PE=3 SV=1 |
| A0A1E4TGL2_9ASCO | 59.09% | 44 | 1e-10 | Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_11308 PE=4 SV=1 |
| CHL1_CANAL | 53.49% | 43 | 2e-10 | ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHL1 PE=3 SV=1 |
| CHL1_YEAST | 46.94% | 49 | 2e-08 | ATP-dependent DNA helicase CHL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHL1 PE=1 SV=1 |
| A0A1E3PRD8_9ASCO | 76.00% | 25 | 7e-07 | ATP-dependent RNA helicase CHL1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81974 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2315
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_06265_1 MTTDLPSFIDESPKSFHHPYTPYQIQLDFMKALYATLNSKKIGIFESPTGTVSLLDFFNTPHLF
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.