Protein
MCA_06259_1
Length
479 amino acids
Gene name: STS1
Description: Tethering factor for nuclear proteasome STS1
Browser: contigD:3705537-3706977-
RNA-seq: read pairs 3791, FPKM 97.6, percentile rank 78.2% (100% = highest expression)
Protein function
| Annotation: | STS1 | Tethering factor for nuclear proteasome STS1 | |
|---|---|---|---|
| KEGG: | K11888 | CUT8 | protein Cut8 |
| EGGNOG: | 0PKVS | STS1 | Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins (By similarity) |
| SGD closest match: | S000001450 | STS1 | Tethering factor for nuclear proteasome STS1 |
| CGD closest match: | CAL0000185317 | STS1 | Tethering factor for nuclear proteasome STS1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05183_1 | 46.89% | 241 | 4e-70 | MIA_05183_1 |
| A0A0J9XLN7_GEOCN | 44.19% | 215 | 4e-58 | Similar to Saccharomyces cerevisiae YIR011C STS1 Protein required for localizing proteasomes to the nucleus OS=Geotrichum candidum GN=BN980_GECA32s02595g PE=3 SV=1 |
| UniRef50_A0A0J9XLN7 | 44.19% | 215 | 7e-55 | Similar to Saccharomyces cerevisiae YIR011C STS1 Protein required for localizing proteasomes to the nucleus n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XLN7_GEOCN |
| A0A167EEB8_9ASCO | 44.14% | 222 | 1e-56 | Sts1p OS=Sugiyamaella lignohabitans GN=STS1 PE=3 SV=1 |
| A0A060TCY1_BLAAD | 36.71% | 286 | 3e-53 | ARAD1D03058p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D03058g PE=3 SV=1 |
| STS1_YARLI | 36.73% | 226 | 4e-46 | Tethering factor for nuclear proteasome STS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STS1 PE=3 SV=1 |
| A0A1E3PI37_9ASCO | 40.18% | 224 | 5e-44 | Cut8-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83138 PE=3 SV=1 |
| STS1_CANAL | 38.36% | 159 | 4e-37 | Tethering factor for nuclear proteasome STS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=STS1 PE=3 SV=1 |
| A0A1E4TL53_9ASCO | 25.71% | 210 | 5e-21 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30637 PE=3 SV=1 |
| STS1_YEAST | 27.39% | 157 | 1e-17 | Tethering factor for nuclear proteasome STS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STS1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0540
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MCA_06259_1 MGLKAVLPPSTSWGFQFHSTAESTSNNTSSSLESSSLKTATAGDNNTSDNISNNNTPNTLAFSNLFVSKPTKRKLPFAED RDDFEDDESNYSSFRNTDLTDRKSPNKFASLNGHNNTLSIESSSTKRQSSHSASLHTSPLYKYHNSSSKQFNGTTANNSI SPSRRGNISRHHTNRIHKRARFERINSRPLPINRLVETLDKKALETLITSLVQQNPHLNNQINQIAPKITISVAISALEG KFQAIFDNLPYKVDPRGDYAYLRVRPYIEEFLHSMHDFICHFLPPHEQQITNSLAFLDSVTMMLHKLPKWNNDAHNSSRR AAYDLICNAWMVTLQEACFVSNNNNNEEHNNNHHTGVTLSLAFGGWQKKLEQHDELSVDHLLIPAVNFIRQELDWINNNN NRLHFNDNDNNYQNSNNNNNNNNNNNNNNNNNDNNNNSFSSNLFSSSPFNSNNNNSNNNNENSQFFGVPSMMGVSASWK
GO term prediction
Biological Process
GO:0031144 proteasome localization
GO:0071630 ubiquitin-dependent catabolism of misfolded proteins by nucleus-associated proteasome
Molecular Function
None predicted.
Cellular Component
GO:0005634 nucleus