Protein
MCA_06097_1
Length
376 amino acids
Gene name: FEN1
Description: Flap endonuclease 1; RAD27
Browser: contigD:3240633-3241967+
RNA-seq: read pairs 463, FPKM 15.2, percentile rank 34.4% (100% = highest expression)
Protein function
| Annotation: | FEN1 | Flap endonuclease 1; RAD27 | |
|---|---|---|---|
| KEGG: | K04799 | FEN1 | flap endonuclease-1 [EC:3.-.-.-] |
| EGGNOG: | 0PFFR | FEN1 | Structure-specific nuclease with 5'-flap endonuclease and 5'-3' exonuclease activities involved in DNA replication and repair. During DNA replication, cleaves the 5'-overhanging flap structure that is generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. It enters the flap from the 5'-end and then tracks to cleave the flap base, leaving a nick for ligation. Also involved in the long patch base excision repair (LP-BER) pathway, by cleaving within the apurinic apyrimidinic (AP) site-terminated flap. Acts as a genome stabilization factor that prevents flaps from equilibrating into structurs that lead to duplications and deletions. Also possesses 5'-3' exonuclease activity on nicked or gapped double- stranded DNA, and exhibits RNase H activity. Also involved in replication and repair of rDNA and in repairing mitochondrial DNA (By similarity) |
| SGD closest match: | S000001596 | RAD27 | Flap endonuclease 1 |
| CGD closest match: | CAL0000190371 | RAD27 | Flap endonuclease 1 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9X3X9_GEOCN | 74.93% | 363 | 0.0 | Flap endonuclease 1 OS=Geotrichum candidum GN=FEN1 PE=3 SV=1 |
| MIA_03662_1 | 75.28% | 356 | 3e-178 | MIA_03662_1 |
| A0A1E3PSX6_9ASCO | 62.98% | 362 | 9e-152 | Flap endonuclease 1 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=FEN1 PE=3 SV=1 |
| A0A060SZC7_BLAAD | 64.92% | 362 | 2e-149 | Flap endonuclease 1 OS=Blastobotrys adeninivorans GN=FEN1 PE=3 SV=1 |
| A0A167C4F9_9ASCO | 68.91% | 312 | 7e-144 | Flap endonuclease 1 OS=Sugiyamaella lignohabitans GN=RAD27 PE=3 SV=1 |
| FEN1_YARLI | 57.37% | 373 | 5e-140 | Flap endonuclease 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FEN1 PE=3 SV=1 |
| UniRef50_Q6C116 | 57.37% | 373 | 1e-136 | Flap endonuclease 1 n=417 Tax=Eukaryota TaxID=2759 RepID=FEN1_YARLI |
| A0A1E4THF0_9ASCO | 58.99% | 356 | 2e-130 | Flap endonuclease 1 OS=Tortispora caseinolytica NRRL Y-17796 GN=FEN1 PE=3 SV=1 |
| FEN1_CANAL | 56.98% | 351 | 2e-129 | Flap endonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD27 PE=3 SV=1 |
| FEN1_YEAST | 56.16% | 365 | 1e-123 | Flap endonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD27 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2286
Protein family membership
- XPG/Rad2 endonuclease (IPR006084)
- Flap endonuclease 1 (IPR023426)
Domains and repeats
-
Domain
-
Domain
-
Domain
1
50
100
150
200
250
300
350
376
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
cd09907 (H3TH_FEN1-Euk)
-
mobidb-lite (disord...)
Residue annotation
-
FEN1-PCNA interfac...
-
3' dsDNA binding s...
-
metal binding site...
-
active site cd09867
-
putative 5' ssDNA ...
-
metal binding site...
-
putative DNA bindi...
-
putative metal bin...
Protein sequence
>MCA_06097_1 MGIHGLFKLMSDQAASAIATREFKNLVGRKVAIFLIAVRQQDGNQLTDDSGETTSHLVGMFYRTLKIIDHGIKPVYVFDG KPPEMKGGELAKRLAQREKAIKAAEELKQAEATNEEISKFERRTVRVSRQQNDEAKRLLKLMGLPYIEAPGEAEAQCAAL AKANKVFAAASEDMDTLTFGAPILLRYLTAQESKGLPVTEINFQTVLDSLELNHDEFIDLCILLGCDYCDSIRGVGPVTA FKLIKEHKSLEKIIEALKSKPNSKYVIPEDWQYEEARKLFKNPDILDPTTVDLKWTKPDVDGLVEFLCKEKGFSEERVRK AAEKLSKGNTAAPQGRLDDFFKMGPKSKTDLKAANKRKKAEMDAKKNKKTKVGRKK
GO term prediction
Biological Process
GO:0006281 DNA repair
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0004518 nuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
Cellular Component
None predicted.