Protein

MCA_06086_1

Length
110 amino acids

Browser: contigD:3210182-3210736-

RNA-seq: read pairs 754, FPKM 83.9, percentile rank 76.0% (100% = highest expression)

Protein function

KEGG:K15171SUPT4H1 transcription elongation factor SPT4
EGGNOG:0PQ6Mtranscription elongation factor SPT4
SGD closest match:S000003295SPT4Transcription elongation factor SPT4
CGD closest match:CAL0000191909SPT4Transcription elongation factor SPT4

Protein alignments

%idAln lengthE-value
MIA_04293_189.09%1105e-73MIA_04293_1
A0A060T3M2_BLAAD77.27%1101e-63Transcription elongation factor SPT4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C38412g PE=3 SV=1
A0A0J9X7K2_GEOCN74.55%1104e-62Transcription elongation factor SPT4 OS=Geotrichum candidum GN=BN980_GECA04s05928g PE=3 SV=1
B5RSL5_YARLI70.00%1103e-59Transcription elongation factor SPT4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F13354g PE=3 SV=1
A0A1E3PJ58_9ASCO70.91%1104e-58Transcription elongation factor SPT4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51487 PE=3 SV=1
A0A1E4TMG9_9ASCO57.27%1103e-50Transcription elongation factor SPT4 OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_49373 PE=3 SV=1
UniRef50_H8X0U958.77%1145e-45Uncharacterized protein n=2 Tax=Saccharomycetales TaxID=4892 RepID=H8X0U9_CANO9
SPT4_CANAL61.61%1121e-48Transcription elongation factor SPT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPT4 PE=3 SV=1
SPT4_YEAST51.46%1032e-31Transcription elongation factor SPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT4 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3330
Predicted cleavage: 29

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 110

Detailed signature matches

  1. Family IPR009287
    Transcription initiation Spt4
    1. PIRSF025023 (Spt4)
  2. Domain IPR029040
    RNA polymerase subunit RPABC4/transcription elongation factor Spt4
    1. SSF63393 (RNA polym...)
  3. Domain IPR022800
    Spt4/RpoE2 zinc finger
    1. PF06093 (Spt4)
    2. SM01389 (Spt4_2)
    3. cd07973 (Spt4)

Residue annotation

  1. Zn binding site cd...
  2. Spt4-Spt5NGN inter...

Protein sequence

>MCA_06086_1
MSTRSERACMICAIIQPYREFVSQGCPNCESLLAFKNDDDLVQDCTSPSFEGLLSVCDTENSWAAKWLRVDGFQPGLYAI
KVNGRLPEDIVRDLEAKGVVYRPRDGSVQD

GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-templated
GO:0032786 positive regulation of DNA-templated transcription, elongation

Molecular Function

GO:0008270 zinc ion binding

Cellular Component

GO:0005634 nucleus