Protein
MCA_05906_1
Length
68 amino acids
Gene name: RPB10
Description: DNA-directed RNA polymerases I, II, and III subunit RPABC5
Browser: contigD:2728098-2728526-
RNA-seq: read pairs 787, FPKM 140.9, percentile rank 84.2% (100% = highest expression)
Protein function
Annotation: | RPB10 | DNA-directed RNA polymerases I, II, and III subunit RPABC5 | |
---|---|---|---|
KEGG: | K03007 | RPB10 | DNA-directed RNA polymerases I, II, and III subunit RPABC5 |
EGGNOG: | 0PRZ2 | RPB10 | DNA-directed RNA |
SGD closest match: | S000005736 | RPB10 | DNA-directed RNA polymerases I, II, and III subunit RPABC5 |
CGD closest match: | CAL0000183011 | orf19.2687.1 | DNA-directed RNA polymerase core subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
UniRef50_A3GGI8 | 88.24% | 68 | 2e-36 | DNA-directed RNA Polymerase II subunit L n=96 Tax=Eukaryota TaxID=2759 RepID=A3GGI8_PICST |
MIA_05036_1 | 87.14% | 70 | 3e-39 | MIA_05036_1 |
B5FVB1_YARLI | 86.57% | 67 | 1e-38 | YALI0B04851p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B04851g PE=3 SV=1 |
A0A1E3PFW5_9ASCO | 85.07% | 67 | 6e-39 | DNA-directed RNA polymerases II subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27121 PE=3 SV=1 |
A0A1D8PLR5_CANAL | 83.82% | 68 | 2e-38 | DNA-directed RNA polymerase core subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2687.1 PE=3 SV=1 |
A0A0J9X8L9_GEOCN | 89.71% | 68 | 3e-38 | Similar to Saccharomyces cerevisiae YOR210W RPB10 RNA polymerase subunit ABC10-beta OS=Geotrichum candidum GN=BN980_GECA05s07028g PE=3 SV=1 |
RPAB5_YEAST | 80.88% | 68 | 1e-34 | DNA-directed RNA polymerases I, II, and III subunit RPABC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB10 PE=1 SV=2 |
A0A060T142_BLAAD | 47.67% | 86 | 1e-14 | ARAD1C17490p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C17490g PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0571
Predicted cleavage: 16
Protein family membership
- DNA-directed RNA polymerase, subunit N/Rpb10 (IPR000268)
Domains and repeats
-
Domain
1
10
20
30
40
50
60
68
Detailed signature matches
-
-
-
PF01194 (RNA_pol_N)
-
PIRSF005653 (RpoN_R...)
-
MF_00250 (RNApol_ar...)
-
-
-
SSF46924 (RNA polym...)
-
-
-
PS01112 (RNA_POL_N_8KD)
-

Unintegrated signatures
Protein sequence
>MCA_05906_1 MIIPVRCFSCGKVVGDKWETYLQYLEEGSTEGEALDKLKLKRYCCRRMILTHVDLIEKFLRYNPLEKN
GO term prediction
Biological Process
GO:0006351 transcription, DNA-templated
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0008270 zinc ion binding
Cellular Component
None predicted.