MCA_05845_1
Gene name: SLM5
Description: mitochondrial asparaginyl-tRNA synthetase; protein with OB-fold nucleic binding domain
Browser: contigD:2525018-2526491+
RNA-seq: read pairs 1606, FPKM 40.4, percentile rank 60.5% (100% = highest expression)
Protein function
| Annotation: | SLM5 | mitochondrial asparaginyl-tRNA synthetase; protein with OB-fold nucleic binding domain | |
|---|---|---|---|
| KEGG: | K01893 | NARS | asparaginyl-tRNA synthetase [EC:6.1.1.22] |
| EGGNOG: | 0PI3Y | SLM5 | Asparaginyl-tRNA synthetase |
| SGD closest match: | S000000618 | SLM5 | Asparagine--tRNA ligase, mitochondrial |
| CGD closest match: | CAL0000182802 | orf19.6698 | Asparagine--tRNA ligase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06350_1 | 64.57% | 494 | 0.0 | MIA_06350_1 |
| A0A0J9XEU9_GEOCN | 64.41% | 472 | 0.0 | Similar to Saccharomyces cerevisiae YCR024C SLM5 Mitochondrial asparaginyl-tRNA synthetase OS=Geotrichum candidum GN=BN980_GECA11s01088g PE=4 SV=1 |
| A0A1E3PEG7_9ASCO | 52.09% | 478 | 1e-177 | Asparaginyl-tRNA synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52794 PE=4 SV=1 |
| A0A167CL17_9ASCO | 52.40% | 458 | 2e-168 | Asparagine--tRNA ligase SLM5 OS=Sugiyamaella lignohabitans GN=SLM5 PE=4 SV=1 |
| UniRef50_A0A167CL17 | 52.40% | 458 | 4e-165 | Asparagine--tRNA ligase SLM5 n=6 Tax=Saccharomycetales TaxID=4892 RepID=A0A167CL17_9ASCO |
| A0A060SZ00_BLAAD | 51.99% | 452 | 1e-164 | ARAD1A15752p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15752g PE=4 SV=1 |
| Q6C700_YARLI | 50.22% | 446 | 5e-154 | YALI0E04939p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E04939g PE=4 SV=1 |
| SYNM_YEAST | 41.85% | 466 | 5e-128 | Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 |
| Q59R23_CANAL | 41.50% | 506 | 1e-123 | Asparagine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6698 PE=4 SV=1 |
| A0A1E4TMF3_9ASCO | 42.00% | 450 | 1e-110 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_147718 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9940
Predicted cleavage: 27
Protein family membership
- Aspartyl/Asparaginyl-tRNA synthetase, class IIb (IPR002312)
- Asparagine-tRNA ligase (IPR004522)
Domains and repeats
-
Domain
Detailed signature matches
no IPR
Residue annotation
-
putative dimer int...
-
putative anticodon...
-
homodimer interfac...
-
motif 1 cd00776
-
motif 2 cd00776
-
active site cd00776
-
motif 3 cd00776
Protein sequence
>MCA_05845_1 MIKLSRFNKRALYKGIRQLSTSSLPLTNKAFFQSVQESQSVSVTGWIKSVRKSKNVAFADISDGTCGTPVSIVMNNPEDA KSLSTGACVEIKGTVQKAPPAKNRVQSYEVVADHIKVWGPTDKDYPLQKKYHTTEFLRTIPEFRWKTNTGTAVMRYRSFA TNKIREYFSNNDFTQVHSPIITSSDCEGGGEVFQLSGGKEGPKFFGEDKAAYLSVSSQLHLEVFTGALSRVWNIAPAFRA EDSNTTRHLSEFWIVEAEIAFITQLNQLMDIVENMIKSAVAPLLDESSPEAKDLLAVKRDAESKQMLLDRWKVMASDNWT RITYTDAVSILNEKYSQDSSIFQGQAPPTWGEGLASVHEKYLAGTLYNGPVFVTDYPIQEKPFYMLQNEPIVVNGKKEQT VSCFDLLVPQIGELVGGSMREHDYEKLLKAMNEKGMNSRDLDWYLKLRQQGSFPHGGYGMGFERFLAYVTGQSNVRDVIG FSRWAGNCVC
GO term prediction
Biological Process
GO:0006418 tRNA aminoacylation for protein translation
GO:0006421 asparaginyl-tRNA aminoacylation
Molecular Function
GO:0000166 nucleotide binding
GO:0003676 nucleic acid binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004816 asparagine-tRNA ligase activity
GO:0005524 ATP binding
Cellular Component
GO:0005737 cytoplasm