Protein

MCA_05843_1

Length
562 amino acids


Gene name: DED81

Description: cytosolic asparaginyl-tRNA synthetase; protein with OB-fold nucleic acidic domain

Browser: contigD:2519923-2521612+

RNA-seq: read pairs 6354, FPKM 139.5, percentile rank 84.0% (100% = highest expression)

Protein function

Annotation:DED81cytosolic asparaginyl-tRNA synthetase; protein with OB-fold nucleic acidic domain
KEGG:K01893NARS asparaginyl-tRNA synthetase [EC:6.1.1.22]
EGGNOG:0PFF1PGUG_05629Asparaginyl-tRNA synthetase
SGD closest match:S000001061DED81Asparagine--tRNA ligase, cytoplasmic
CGD closest match:CAL0000197236DED81Asparagine--tRNA ligase

Protein alignments

%idAln lengthE-value
MIA_06354_180.18%5600.0MIA_06354_1
A0A0J9XDT3_GEOCN75.93%5650.0Similar to Saccharomyces cerevisiae YHR019C DEB81 Cytosolic asparaginyl-tRNA synthetase OS=Geotrichum candidum GN=BN980_GECA11s01099g PE=4 SV=1
A0A167BXP5_9ASCO70.55%5670.0Asparagine--tRNA ligase DED81 OS=Sugiyamaella lignohabitans GN=DED81 PE=4 SV=1
A0A1E3PER5_9ASCO68.50%5650.0Asparaginyl-tRNA synthetase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52791 PE=4 SV=1
A0A060TCI7_BLAAD71.78%5670.0ARAD1D42702p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D42702g PE=4 SV=1
Q6C6Z7_YARLI69.96%5660.0YALI0E05005p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E05005g PE=4 SV=1
UniRef50_A0A109V01667.03%5490.0HGL199Wp n=3 Tax=Ascomycota TaxID=4890 RepID=A0A109V016_9SACH
SYNC_YEAST68.06%5510.0Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1
Q59R18_CANAL61.58%5570.0Asparagine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED81 PE=4 SV=1
A0A1E4T9Z8_9ASCO63.24%5250.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_57723 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0322

Protein family membership

Domains and repeats

Detailed signature matches

    1. PR01042 (TRNASYNTHASP)
    1. SSF50249 (Nucleic a...)
    1. PF01336 (tRNA_anti-...)
    1. PS50862 (AA_TRNA_LI...)
    1. PF00152 (tRNA-synt_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55681 (Class II ...)
  2. cd00776 (AsxRS_core)
  3. cd04323 (AsnRS_cyto...)

Residue annotation

  1. putative dimer int...
  2. putative anticodon...
  3. homodimer interfac...
  4. motif 1 cd00776
  5. motif 2 cd00776
  6. active site cd00776
  7. motif 3 cd00776

Protein sequence

>MCA_05843_1
MSADLTQKVADVKIADGPIFYVNESKGADDSSADGSQEKPFKTPAYAVYVAANASIKVFKDEEYQPISPSAMKKAVKGAE
GLRKKAEKAKKLEEQKALKEIEDQKKIEASKHIVIKEDSSLPEAQKIKIKDAQESRGKRIKVSGWIHRFRPQKGVAFIVL
RDGTGFLQAVLSGDLANAYQTQTLTLESTVTLYGIISPVPEGQNAPGGHELAVDYYEVVGLAPSGDDAITNKVQENADPS
LLLDQRHLTLRGDTLSAVMKVRAGFLHYIREVYVDEGLLEVTPPCLVQTQVEGGSTLFKLDYYSQEAYLTQSSQLYLETC
VPALGDVYCIQESFRAERSHTRRHLSEYTHIEAELGFLTFNDLLDHIERVICGVVDKLLADPYYAELIEQLNPGFKAPAR
PFKRMSYESALEWLNENNVPNEEGKPFTFGDDIAEAAERKMTDTIGVPILLTKFPVEIKSFYMKKVKEDPRVTESVDVLM
PNVGEITGGSMRIDDTEELLAGFKRENIDPKSYYWFIDQRKYGTFPHGGYGLGTERILAWLCNRFTVRECSLYPRFTGRA
TP

GO term prediction

Biological Process

GO:0006418 tRNA aminoacylation for protein translation
GO:0006421 asparaginyl-tRNA aminoacylation

Molecular Function

GO:0000166 nucleotide binding
GO:0003676 nucleic acid binding
GO:0004812 aminoacyl-tRNA ligase activity
GO:0004816 asparagine-tRNA ligase activity
GO:0005524 ATP binding

Cellular Component

GO:0005737 cytoplasm