MCA_05764_1
Gene name: COX10
Description: Protoheme IX farnesyltransferase, mitochondrial
Browser: contigD:2276694-2278533+
RNA-seq: read pairs 2202, FPKM 44.4, percentile rank 62.6% (100% = highest expression)
Protein function
| Annotation: | COX10 | Protoheme IX farnesyltransferase, mitochondrial | |
|---|---|---|---|
| KEGG: | K02257 | COX10 | protoheme IX farnesyltransferase [EC:2.5.1.-] |
| EGGNOG: | 0PFA5 | COX10 | Converts protoheme IX and farnesyl diphosphate to heme O (By similarity) |
| SGD closest match: | S000006093 | COX10 | Protoheme IX farnesyltransferase, mitochondrial |
| CGD closest match: | CAL0000197403 | orf19.3167 | Protoheme IX farnesyltransferase, mitochondrial |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03495_1 | 60.18% | 545 | 0.0 | MIA_03495_1 |
| A0A0J9X4M7_GEOCN | 64.32% | 440 | 2e-174 | Protoheme IX farnesyltransferase, mitochondrial OS=Geotrichum candidum GN=BN980_GECA03s01209g PE=3 SV=1 |
| A0A161HHW8_9ASCO | 68.15% | 336 | 1e-145 | Protoheme IX farnesyltransferase, mitochondrial OS=Sugiyamaella lignohabitans GN=COX10 PE=3 SV=1 |
| COX10_YARLI | 65.19% | 339 | 1e-139 | Protoheme IX farnesyltransferase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COX10 PE=3 SV=1 |
| UniRef50_Q6C0L2 | 65.19% | 339 | 3e-136 | Protoheme IX farnesyltransferase, mitochondrial n=24 Tax=Saccharomycetales TaxID=4892 RepID=COX10_YARLI |
| A0A060T4H2_BLAAD | 64.99% | 337 | 6e-139 | Protoheme IX farnesyltransferase, mitochondrial OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03476g PE=3 SV=1 |
| A0A1E3PP24_9ASCO | 64.20% | 338 | 1e-135 | Protoheme IX farnesyltransferase, mitochondrial OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81747 PE=3 SV=1 |
| COX10_YEAST | 58.11% | 339 | 2e-123 | Protoheme IX farnesyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COX10 PE=3 SV=1 |
| A0A1D8PNE8_CANAL | 57.31% | 342 | 3e-119 | Protoheme IX farnesyltransferase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3167 PE=3 SV=1 |
| A0A1E4TGJ5_9ASCO | 49.42% | 342 | 6e-96 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25060 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3041
Protein family membership
- UbiA prenyltransferase family (IPR000537)
- Protohaem IX farnesyltransferase (IPR006369)
- Protohaem IX farnesyltransferase, mitochondria (IPR016315)
- Protohaem IX farnesyltransferase (IPR006369)
Domains and repeats
Detailed signature matches
-
-
PF01040 (UbiA)
-
-
-
PIRSF001773 (COX10)
-
-
-
PS00943 (UBIA)
-
no IPR
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MCA_05764_1 MLTSQVRLTGGSLRSRKVDQSIEISKACRKLFSSLTSTSHSSVFSLRVNNSNYNDIDGADYFASCNRRNYFTMNSTPLRR RKFSSSSSLLSSSATAPSKSDQSSFSFDFLSNTFLQLSSTYSTTTTSKKQEEKTGNITDKATATATPIKNETATAEFPSS NPFPTPIRVNLIPDSKPVVNFASKAFSCTDDSTSIQAKSTEENLSKQSLDKSVLASAATSTTAANEKPLFTAVPVDSVSR TRTKSKSKDRSELSKLVSPYIALTKPRLSALVVLSAMSAYALTPYDATLSQLLFLTVGTTLASGSANAINMGREHIFDGM MTRTRTRPVVRKQVTPTQAFTFAGISGITGVAALYFGVNPTVALLGGSNIILYGWIYTSLKRKSITNTWVGAIVGALPPL MGWAASSSLMDPCAWCLAGLLYAWQFPHFNALSYSIRDEYRRAGYVMAAWTNPSLNARVALRHSIAMFPICIGLSYFGIT DWVFAFDSSAVNAWLTYWAYKFWLEQRNVPPVAKHNGVLLPTAGSSGSQSLASSSSTSSNSGYSSSSSSSSSSSSAKTNG FARKLFWGSVIHLPAILVLAMIHKKGQWDWLFGPSTTEEQEEELLAVEAEAI
GO term prediction
Biological Process
GO:0006783 heme biosynthetic process
GO:0048034 heme O biosynthetic process
Molecular Function
GO:0008495 protoheme IX farnesyltransferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
Cellular Component
GO:0016021 integral component of membrane
GO:0031966 mitochondrial membrane