Protein
MCA_05677_1
Length
110 amino acids
Gene name: RPC11
Description: DNA-directed RNA polymerase III subunit RPC10
Browser: contigD:2010805-2011194+
RNA-seq: read pairs 306, FPKM 34.1, percentile rank 56.3% (100% = highest expression)
Protein function
| Annotation: | RPC11 | DNA-directed RNA polymerase III subunit RPC10 | |
|---|---|---|---|
| KEGG: | K03019 | RPC11 | DNA-directed RNA polymerase III subunit RPC11 |
| EGGNOG: | 0PQ6F | RPC11 | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity) |
| SGD closest match: | S000002452 | RPC11 | DNA-directed RNA polymerase III subunit RPC10 |
| CGD closest match: | CAL0000198439 | RPC11 | DNA-directed RNA polymerase subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_06280_1 | 90.00% | 110 | 2e-74 | MIA_06280_1 |
| A0A0J9X5L0_GEOCN | 76.79% | 112 | 5e-62 | DNA-directed RNA polymerase subunit OS=Geotrichum candidum GN=BN980_GECA03s06203g PE=3 SV=1 |
| Q5A5N9_CANAL | 72.32% | 112 | 4e-57 | DNA-directed RNA polymerase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPC11 PE=3 SV=1 |
| A0A060TJ31_BLAAD | 68.75% | 112 | 4e-57 | DNA-directed RNA polymerase subunit OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D43538g PE=3 SV=1 |
| UniRef50_A3LW94 | 70.54% | 112 | 8e-52 | DNA-directed RNA polymerase subunit n=158 Tax=Fungi TaxID=4751 RepID=A3LW94_PICST |
| A0A1E3PEJ2_9ASCO | 67.86% | 112 | 5e-53 | DNA-directed RNA polymerase subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27623 PE=3 SV=1 |
| RPC10_YEAST | 61.06% | 113 | 7e-47 | DNA-directed RNA polymerase III subunit RPC10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC11 PE=1 SV=1 |
| Q6C866_YARLI | 54.05% | 111 | 1e-41 | DNA-directed RNA polymerase subunit OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D22308g PE=3 SV=1 |
| A0A1E4TMG5_9ASCO | 55.45% | 110 | 3e-40 | DNA-directed RNA polymerase subunit OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_95448 PE=3 SV=1 |
| A0A167CJP6_9ASCO | 31.25% | 80 | 7e-09 | Dst1p OS=Sugiyamaella lignohabitans GN=DST1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0560
Protein family membership
- DNA-directed RNA polymerase subunit/transcription factor S (IPR012164)
- Transcription factor S (IPR006288)
Domains and repeats
-
Domain
1
20
40
60
80
100
110
Detailed signature matches
-
-
PIRSF005586 (RNApol...)
-
-
-
cd10509 (Zn-ribbon_...)
-
no IPR
Unintegrated signatures
-
-
-
SSF57783 (Zinc beta...)
Residue annotation
-
Zn binding site cd...
Protein sequence
>MCA_05677_1 MLTFCPNCSNLLQISVGSTGNNRFECRTCPYEFAIVEPMVMFHRRRTERKEIDDVLGGQGSWDNVDQTRAQCPACGHDKA YFFQLQIRSADEPMTTFYKCVKCAHQWREN
GO term prediction
Biological Process
GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated
GO:0006379 mRNA cleavage
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
Cellular Component
None predicted.