Protein

MCA_05664_1

Length
795 amino acids

Gene name: KU70

Description: ATP-dependent DNA helicase II subunit 1

Browser: contigD:1960934-1963322+

RNA-seq: read pairs 1180, FPKM 18.3, percentile rank 39.1% (100% = highest expression)

Protein function

Annotation:KU70ATP-dependent DNA helicase II subunit 1
KEGG:K10884XRCC6 ATP-dependent DNA helicase 2 subunit 1
EGGNOG:0PFW8KU70Single stranded DNA-dependent ATP-dependent helicase. Involved in non-homologous end joining (NHEJ) DNA double strand break repair. DNA-binding is sequence-independent but has a high affinity to nicks in double stranded DNA and to the ends of duplex DNA. Binds to naturally occurring chromosomal ends, and therefore provides chromosomal end protection. Required also for telomere recombination to repair telomeric ends in the absence of telomerase. ku70, of the ku70 ku80 heterodimer, binds to the stem loop of tlc1, the RNA component of telomerase. Involved in telomere maintenance. Interacts with telomeric repeats and subtelomeric sequences thereby controlling telomere length and protecting against subtelomeric rearrangement. Maintains telomeric chromatin, which is involved in silencing the expression of genes located at the telomere. Required for mating-type switching (By similarity)
SGD closest match:S000004897YKU70ATP-dependent DNA helicase II subunit 1
CGD closest match:CAL0000186914CAS1ATP-dependent DNA helicase

Protein alignments

%idAln lengthE-value
MIA_03882_128.48%7903e-85MIA_03882_1
A0A0J9XI50_GEOCN28.75%6542e-65Similar to Saccharomyces cerevisiae YMR284W YKU70 Subunit of the telomeric Ku complex (Yku70p-Yku80p) OS=Geotrichum candidum GN=BN980_GECA19s02155g PE=4 SV=1
UniRef50_A0A0J9XI5028.75%6545e-62Similar to Saccharomyces cerevisiae YMR284W YKU70 Subunit of the telomeric Ku complex (Yku70p-Yku80p) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XI50_GEOCN
A0A060TBQ9_BLAAD25.80%5622e-50ARAD1D36938p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36938g PE=4 SV=1
A0A1E3PT04_9ASCO24.07%7022e-42Ku DNA-binding complex, Ku70 subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_63968 PE=4 SV=1
KU70_YARLI24.78%5693e-42ATP-dependent DNA helicase II subunit 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KU70 PE=3 SV=1
A0A167C337_9ASCO27.23%3825e-34Yku70p OS=Sugiyamaella lignohabitans GN=YKU70 PE=4 SV=1
A0A1E4TM08_9ASCO21.95%5651e-23Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1273 PE=4 SV=1
A0A1D8PF81_CANAL25.09%2751e-17ATP-dependent DNA helicase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS1 PE=4 SV=1
KU70_YEAST22.44%4593e-12ATP-dependent DNA helicase II subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKU70 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0094

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 700 795

Detailed signature matches

  1. Domain IPR002035
    von Willebrand factor, type A
    1. SSF53300 (vWA-like)
    2. G3DSA:3.40.50...
  2. Domain IPR016194
    SPOC-like, C-terminal domain
    1. SSF100939 (SPOC dom...)
    2. G3DSA:2.40.29...
  3. Domain IPR006164
    Ku70/Ku80 beta-barrel domain
    1. PF02735 (Ku)
    2. SM00559 (ku_4)
  4. Domain IPR005160
    Ku70/Ku80 C-terminal arm
    1. PF03730 (Ku_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.10.16...
  2. cd00788 (KU70)
  3. mobidb-lite (disord...)

Residue annotation

  1. DNA binding site c...
  2. heterodimer interf...

Protein sequence

>MCA_05664_1
MSSSNWDDIDNFEEEEYFDEDFFESEKDAIVFIIEATDSFYTKWAKPLTYETGFESREHKHALMYLLEIITRFLFRRLID
SKQGLAGIIIVNGSYKDIKTEDEKESKSQNEYSEVSSQDGCHLFMDLSVPSIDKLKHLKLMSVSNEEFSKYFTPTTDSST
GLANAFYLANKLLTSQKNTKTKTYNSKRVVFITDRDTPLDFQAQKLAIKTRVKDLVQQDVELIPYFINPISETEIKQEYS
EYLDEKSAFNIAKFYEDILFLSMTKEIDPSLLIPKNLFEIDLLKDKQFKYLQATKRALFSSVLQLSDNIQIGIKGYNLIQ
KSKVPQPSTICATYIKKITKKDDEKDTEAHEEEYCDNRELVVRKRIALSLETGNTVNQSDIIRSIRIGDQLIPCTPEQVE
SLKKLPETIFPCSPETGKPKSIFKLVGFKDASAISWHYNLTKSVFLYPSDSTLVNSKRAFTALYKSLIKKNKVAIVWAVP
RSNSTPVMGALMPYPSDESEVEILKQHYLSTIPRRDDESSGNNDKKRYSANDSKSVYPMGLYFVPLPFADDIRDKPVKKL
YKELDFIIRDDTTSEQVTGREALTNRMGQIIERLFMKAGYEPKRYPNPQLRNFYKVFEQSVFEEEYNEEEADLFSMTKTT
TGEQKISIDMKSLLRLQKLDPTLPKYTSIYSRAGEEIEKWNELLQSVVLTTQESVPALPVDAVKKRKRGGDESSSTDASA
AKSSKRTKQDIMYAQKHELFTVFQSLQTLPGPIKARYQDYTEDDLRSFITHVGIKTKAVKRSGLEAAITKYFDSL

GO term prediction

Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining

Molecular Function

GO:0003677 DNA binding
GO:0004003 ATP-dependent DNA helicase activity

Cellular Component

None predicted.