Protein

MCA_05501_1

Length
301 amino acids

Gene name: DPH5

Description: Diphthine methyl ester synthase

Browser: contigD:1482422-1483400-

RNA-seq: read pairs 1661, FPKM 68.0, percentile rank 71.9% (100% = highest expression)

Protein function

Annotation:DPH5Diphthine methyl ester synthase
KEGG:K00586DPH5 diphthine methyl ester synthase [EC:2.1.1.314]
EGGNOG:0PGKFDPH5S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF- 2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis (By similarity)
SGD closest match:S000004162DPH5Diphthine methyl ester synthase

Protein alignments

%idAln lengthE-value
MIA_02796_186.41%2871e-178MIA_02796_1
DPH51_CANAL79.37%2862e-159Diphthine methyl ester synthase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH5 PE=3 SV=2
A0A060T3E6_BLAAD81.47%2865e-158ARAD1C32516p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32516g PE=3 SV=1
A0A167C7Z2_9ASCO78.40%2871e-157Diphthine synthase OS=Sugiyamaella lignohabitans GN=DPH5 PE=3 SV=1
A0A0J9XG75_GEOCN76.63%2917e-154Similar to Saccharomyces cerevisiae YLR172C DPH5 Methyltransferase required for synthesis of diphthamide OS=Geotrichum candidum GN=BN980_GECA15s00615g PE=3 SV=1
A0A1E3PEY5_9ASCO75.86%2907e-153Diphthamide biosynthesis methyltransferase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_27882 PE=3 SV=1
DPH5_YARLI71.78%2878e-146Diphthine methyl ester synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH5 PE=3 SV=1
UniRef50_Q6C1E071.78%2872e-142Diphthine methyl ester synthase n=160 Tax=Eukaryota TaxID=2759 RepID=DPH5_YARLI
DPH5_YEAST71.68%2863e-138Diphthine methyl ester synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH5 PE=1 SV=1
A0A1E4T9H4_9ASCO69.50%2821e-130Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32998 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1259

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 301

Detailed signature matches

  1. Family IPR004551
    Diphthine synthase
    1. TIGR00522
    2. cd11647 (Diphthine_...)
    3. MF_01084 (Diphthine...)
    4. PIRSF036432 (Diphth...)
  2. Domain IPR014777
    Tetrapyrrole methylase, subdomain 1
    1. G3DSA:3.40.10...
  3. Domain IPR000878
    Tetrapyrrole methylase
    1. SSF53790 (Tetrapyrr...)
    2. PF00590 (TP_methylase)
  4. Domain IPR014776
    Tetrapyrrole methylase, subdomain 2
    1. G3DSA:3.30.95...

Residue annotation

  1. homodimer interfac...
  2. SAM binding site c...

Protein sequence

>MCA_05501_1
MLYLIGLGLSDATDITVRGLETVKKCKRVYLEAYTSILMATDQKGLEEFYGREVILADRELVESGSDDILKDADTEDVAF
LVVGDPLGATTHTDLILRARELKIPYNVIHNASIMNAVGACGLQLYNFGQTVSLVFFTDTWKPESFYEKILENRRLGLHT
LLLLDIKVKEQSIENMARGRLIYEPPRYMSIATAAQQLLEIEEKRQEHAYGPNTPCVGVSRLGSPTQAFRADTLSELAEY
DAGEPLHSLVILGNKVHELEVDYILDFSPDKERLKNAIKEDAENFKKPVPVVVEEEDDDDL

GO term prediction

Biological Process

GO:0008152 metabolic process
GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine

Molecular Function

GO:0004164 diphthine synthase activity
GO:0008168 methyltransferase activity

Cellular Component

None predicted.