Protein

MCA_05491_1

Length
228 amino acids

Gene name: DFR1

Description: Dihydrofolate reductase

Browser: contigD:1451709-1452396-

RNA-seq: read pairs 492, FPKM 26.5, percentile rank 49.3% (100% = highest expression)

Protein function

Annotation:DFR1Dihydrofolate reductase
KEGG:K00287folA dihydrofolate reductase [EC:1.5.1.3]
EGGNOG:0PPTWDFR1dihydrofolate reductase
SGD closest match:S000005762DFR1Dihydrofolate reductase
CGD closest match:CAL0000177250DFR1Dihydrofolate reductase

Protein alignments

%idAln lengthE-value
A0A167FPM6_9ASCO43.36%2262e-55Dihydrofolate reductase OS=Sugiyamaella lignohabitans GN=DFR1 PE=3 SV=1
UniRef50_A0A167FPM643.36%2265e-52Dihydrofolate reductase n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167FPM6_9ASCO
A0A060T4G3_BLAAD41.36%2201e-51ARAD1A17072p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17072g PE=3 SV=1
A0A1E3PD95_9ASCO39.33%2393e-51Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53532 PE=3 SV=1
Q6CC38_YARLI40.72%2217e-48YALI0C12771p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C12771g PE=3 SV=1
A0A0J9XJB7_GEOCN36.52%2302e-38Similar to Saccharomyces cerevisiae YOR236W DFR1 Dihydrofolate reductase OS=Geotrichum candidum GN=BN980_GECA18s02342g PE=3 SV=1
DYR_YEAST35.74%2351e-32Dihydrofolate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFR1 PE=1 SV=2
Q5A5E0_CANAL33.62%2297e-33Dihydrofolate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFR1 PE=3 SV=1
A0A1E4TIE2_9ASCO35.62%2196e-32Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18002 PE=3 SV=1
MIA_04403_134.17%1202e-14MIA_04403_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8737
Predicted cleavage: 69

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 228

Detailed signature matches

  1. Family IPR012259
    Dihydrofolate reductase
    1. PR00070 (DHFR)
  2. Domain IPR024072
    Dihydrofolate reductase-like domain
    1. G3DSA:3.40.43...
    2. SSF53597 (Dihydrofo...)
  3. Domain IPR001796
    Dihydrofolate reductase domain
    1. PF00186 (DHFR_1)
    2. cd00209 (DHFR)
    3. PS51330 (DHFR_2)
  4. SITE IPR017925
    Dihydrofolate reductase conserved site
    1. PS00075 (DHFR_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. SIGNAL_PEPTIDE (Sig...)
  3. SIGNAL_PEPTID... (S...)
  4. SIGNAL_PEPTID... (S...)
  5. SIGNAL_PEPTID... (S...)
  6. TMhelix

Residue annotation

  1. folate binding sit...
  2. NADP+ binding site...

Protein sequence

>MCA_05491_1
MAATKKPVSLILAAAVPSMGIGLNGTLPWNLSKEMAYFRQVTTKSVVIMGKTTWESIPLKFRPLKNRVNVVISSTLYKDN
SDIYKDDQALNIKNSPVLYYKNFDTALNHIDKLYSDLPIYVIGGVQLYTSVLDHERVKNVLLTEVKKISVSPEDSSQYDT
IECDSFFTAFPWYPKNTDEISINQKEWIRQSFDSLKAFVPEAISLENKPISENGFEYEFTLWNRNQQN

GO term prediction

Biological Process

GO:0006545 glycine biosynthetic process
GO:0009165 nucleotide biosynthetic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004146 dihydrofolate reductase activity
GO:0050661 NADP binding

Cellular Component

None predicted.