Protein

MCA_05369_1

Length
194 amino acids

Gene name: TSA1

Description: Peroxiredoxin TSA1

Browser: contigD:1148977-1149562+

RNA-seq: read pairs 87567, FPKM 5548.6, percentile rank 99.7% (100% = highest expression)

Protein function

Annotation:TSA1Peroxiredoxin TSA1
KEGG:K03386PRDX2_4 peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]
EGGNOG:0PJ5TTSA1Peroxiredoxin
SGD closest match:S000004490TSA1Peroxiredoxin TSA1
CGD closest match:CAL0000174369TSA1Peroxiredoxin TSA1-A

Protein alignments

%idAln lengthE-value
MIA_00492_187.43%1912e-116MIA_00492_1
A0A0J9XF13_GEOCN80.75%1878e-104Similar to Saccharomyces cerevisiae YML028W TSA1 Thioredoxin peroxidase OS=Geotrichum candidum GN=BN980_GECA12s04025g PE=4 SV=1
UniRef50_A0A0L0P0E176.56%1926e-99Peroxiredoxin tsa1 n=7 Tax=Opisthokonta TaxID=33154 RepID=A0A0L0P0E1_9ASCO
A0A060TI57_BLAAD77.54%1875e-100ARAD1D36322p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D36322g PE=4 SV=1
A0A1E4TLC0_9ASCO75.77%1944e-100Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30677 PE=4 SV=1
TSA1_CANAL73.30%1918e-100Peroxiredoxin TSA1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TSA1 PE=2 SV=1
Q6CEJ7_YARLI74.35%1915e-98YALI0B15125p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B15125g PE=4 SV=1
A0A1E3PH20_9ASCO72.25%1914e-97Thioredoxin-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47432 PE=4 SV=1
A0A167E6Z8_9ASCO74.60%1897e-96Thioredoxin peroxidase TSA1 OS=Sugiyamaella lignohabitans GN=TSA1 PE=4 SV=1
TSA1_YEAST71.73%1912e-90Peroxiredoxin TSA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TSA1 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0493

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 180 194

Detailed signature matches

  1. Family IPR024706
    Peroxiredoxin, AhpC-type
    1. PIRSF000239 (AHPC)
  2. Domain IPR012336
    Thioredoxin-like fold
    1. SSF52833 (Thioredox...)
  3. Domain IPR013766
    Thioredoxin domain
    1. PS51352 (THIOREDOXIN_2)
  4. Domain IPR000866
    Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
    1. PF00578 (AhpC-TSA)
  5. Domain IPR019479
    Peroxiredoxin, C-terminal
    1. PF10417 (1-cysPrx_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:3.30.10...
  3. G3DSA:3.40.30.10
  4. NON_CYTOPLASM... (N...)
  5. SFLDS00024 (Peroxir...)
  6. TRANSMEMBRANE (Tran...)
  7. cd03015 (PRX_Typ2cys)

Residue annotation

  1. dimer interface cd...
  2. decamer (pentamer ...
  3. SFLDS00024
  4. catalytic triad cd...
  5. peroxidatic and re...

Protein sequence

>MCA_05369_1
MVFIGQQAPAFKKTAVVDGLFQEVSLEQYKGKWVVLGFFPLAFTFVCPTEIIAFSEAAEEFKKRNTEVLLASTDSEFSLL
AWTNVARKDGGLGEIKIPLVADTNHSLSRDYGVLIEEDGVALRGLFLIDPNGKLRQITINDLPVGRSVDETLRLVDAFQF
TEEHGEVCPANWHKGDATMVPDPKKSKEYFSKAN

GO term prediction

Biological Process

GO:0045454 cell redox homeostasis
GO:0055114 oxidation-reduction process

Molecular Function

GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0051920 peroxiredoxin activity

Cellular Component

None predicted.