Protein

MCA_05211_1

Length
782 amino acids


Gene name: SIS2

Description: Phosphopantothenoylcysteine decarboxylase subunit SIS2

Browser: contigD:635158-637507-

RNA-seq: read pairs 2339, FPKM 36.9, percentile rank 58.6% (100% = highest expression)

Protein function

Annotation:SIS2Phosphopantothenoylcysteine decarboxylase subunit SIS2
EGGNOG:0PGJMSIS2Component of the phosphopantothenoylcysteine decarboxylase (PPCDC) involved in the coenzyme A synthesis. Acts as an inhibitory subunit of protein phosphatase PPZ1, which is involved in many cellular processes such as G1-S transition or salt tolerance
SGD closest match:S000001780SIS2Phosphopantothenoylcysteine decarboxylase subunit SIS2
CGD closest match:CAL0000188367orf19.7378Phosphopantothenoylcysteine decarboxylase complex subunit

Protein alignments

%idAln lengthE-value
MIA_06020_191.55%2139e-139MIA_06020_1
A0A0J9XCS5_GEOCN87.62%2021e-126Similar to Saccharomyces cerevisiae YKR072C SIS2 Negative regulatory subunit of protein phosphatase 1 Ppz1p and also a subunit of the phosphopantothenoylcysteine decarboxylase OS=Geotrichum candidum GN=BN980_GECA09s03640g PE=4 SV=1
UniRef50_A0A0J9XCS587.62%2022e-123Similar to Saccharomyces cerevisiae YKR072C SIS2 Negative regulatory subunit of protein phosphatase 1 Ppz1p and also a subunit of the phosphopantothenoylcysteine decarboxylase n=2 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XCS5_GEOCN
A0A1E3PJQ1_9ASCO82.18%2026e-118Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46315 PE=4 SV=1
Q6CCV1_YARLI80.50%2002e-114YALI0C06281p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C06281g PE=4 SV=1
A0A167BY42_9ASCO79.60%2014e-106Phosphopantothenoylcysteine decarboxylase complex subunit SIS2 OS=Sugiyamaella lignohabitans GN=SIS2 PE=4 SV=1
A0A060TD17_BLAAD74.13%2013e-106ARAD1D44132p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D44132g PE=4 SV=1
A0A1D8PKD2_CANAL66.67%2073e-94Phosphopantothenoylcysteine decarboxylase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7378 PE=4 SV=1
SIS2_YEAST55.23%2399e-87Phosphopantothenoylcysteine decarboxylase subunit SIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS2 PE=1 SV=1
A0A1E4TCV6_9ASCO48.24%2554e-70Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4202 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0068

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
1 100 200 300 400 500 600 700 782

Detailed signature matches

    1. SSF52507 (Homo-olig...)
    2. PF02441 (Flavoprotein)
    1. SSF48371 (ARM repeat)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MCA_05211_1
MGSDNTGLLAQSTKDSEVDPNGSKTSVPVKKLDTEPLPPPSIKSFAEKSLEVDTATPLPPKQVQLSPRGASHTTNHPPFP
PPASPAPTPISEEDAKKEATKLTEKIGKVKGKVVVNSPSSSDPNCIKPTPGLLTKPVLSSEELQHLSGSESIFTNLNSSG
NANPSGTQFNNVAASQRHDSVGSDRVKSSESSASNSSPGTGSSNSDSTQSTASLAGANVPPPPPKQPSVHAHFLLEEVVG
HIGGRSRSGSGTFSHPPGVAPVVNGSGIINSNATLAAASARLKSPELGPTSSSTSSSRVPSITANSSNQQQQQQNQQQTP
TNNSGANQRTSSNKPVSFSNQGITSPSLKGITVPAGTSPILNPADICPSKTTGMSSTPSPNIDDVISLSDPLSGKITTST
TTSVLGSNNNSNGGGIPATSAATPHATTISAPTIPPKQTIPAGGTDIPTDPRLPQDDGKLHILLAATGSISTGKLRLIIN
KLKEIYGLERASIQIVLTKAAENFVSRGEIPSYVRIWRDQDEWATWNGRSDPVVHIELRRWADILVIAPLSANTLGKIAL
GLCDNLLTNVVRAWNTQYPILIAPSMVPYAYNNPATKRHLEVIKQEMGWIEVLKPVEKVVGSYGDIGMGGMMDWNEIVNK
IVMKLGGYPDEEDDDDDNDNDNDDDNDDDDDDDDDDDDDDDDANDSTDNNDVKIAKIPADQEATAVNKSKSILDNEKRID
STTKSETADLKNKDHVDAKKSKPKKKEIESEFDDDDLDVVLNKLSLAQRDNLEELKHPKSKD

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003824 catalytic activity
GO:0005488 binding

Cellular Component

None predicted.