Protein
MCA_05158_1
Length
751 amino acids
Gene name: COG6
Description: Conserved oligomeric Golgi complex subunit 6
Browser: contigD:494647-496903+
RNA-seq: read pairs 1341, FPKM 22.0, percentile rank 44.0% (100% = highest expression)
Protein function
Annotation: | COG6 | Conserved oligomeric Golgi complex subunit 6 | |
---|---|---|---|
KEGG: | K20293 | COG6 | conserved oligomeric Golgi complex subunit 6 |
EGGNOG: | 0PIBC | COG6 | Acts as component of the peripheral membrane COG complex that is involved in intra-Golgi protein trafficking. COG is located at the cis-Golgi, and regulates tethering of retrograde intra-Golgi vesicles and possibly a number of other membrane trafficking events (By similarity) |
SGD closest match: | S000004986 | COG6 | Conserved oligomeric Golgi complex subunit 6 |
CGD closest match: | CAL0000198191 | COG6 | Conserved oligomeric Golgi complex subunit 6 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MIA_04809_1 | 59.39% | 756 | 0.0 | MIA_04809_1 |
A0A0J9X8L3_GEOCN | 47.14% | 734 | 0.0 | Similar to Saccharomyces cerevisiae YNL041C COG6 Component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking OS=Geotrichum candidum GN=BN980_GECA05s06940g PE=4 SV=1 |
UniRef50_A0A0J9X8L3 | 47.14% | 734 | 0.0 | Similar to Saccharomyces cerevisiae YNL041C COG6 Component of the conserved oligomeric Golgi complex (Cog1p through Cog8p), a cytosolic tethering complex that functions in protein trafficking n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X8L3_GEOCN |
A0A060SZ79_BLAAD | 37.38% | 733 | 3e-148 | ARAD1C06182p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06182g PE=4 SV=1 |
A0A167EXA4_9ASCO | 34.65% | 733 | 9e-127 | Cog6p OS=Sugiyamaella lignohabitans GN=COG6 PE=4 SV=1 |
A0A1E3PL83_9ASCO | 34.40% | 753 | 4e-122 | Oligomeric complex COG6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50122 PE=4 SV=1 |
Q6C1G5_YARLI | 30.00% | 720 | 3e-91 | YALI0F16467p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F16467g PE=4 SV=1 |
COG6_CANAL | 23.84% | 755 | 2e-41 | Conserved oligomeric Golgi complex subunit 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COG6 PE=3 SV=2 |
A0A1E4TDN1_9ASCO | 23.36% | 595 | 1e-35 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4440 PE=4 SV=1 |
COG6_YEAST | 21.63% | 698 | 1e-20 | Conserved oligomeric Golgi complex subunit 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COG6 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0101
Protein family membership
- Conserved oligomeric Golgi complex subunit 6 (IPR010490)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MCA_05158_1 MTTLDLPEKSETLSRPDNAFSQKVASILSTSYTDADIRKAIASLDSRLQENSGYSRRHLRYNTEAEVIASNAAALKDYSK LVNKLEMLGSTIDQLASSFNEMSTKASTNSNNLSSTFLNEATSLISERNNVKVRKMLLNSFKQKFIISPYQVKVLTSSSH PIDDEFFNCFQQVKKTHEDCQALLATEDQQMGLDIMSTTSTYLDKAYDRLFFTVQRDLKTAMESATNKNNASSGEGNKED IELRKKLARSLAVLSERPNLFESAIQSLAESRNRLVSSKFIDALTVDTRIEKAIDFYAYDPLRYVGDMLAYVHSEIVGER ETISGLFKYNDEYHKKEKEKKEEEEDNTINSVWSGLFNPEETTPQLLDKITSAMVKPLKARVENVIALETRVPTVYQLID KIKFYESMYDKAFFNKTQLQNTEDDKTTAATTTTTIPEIIKCLNQLAEYGWRQFSKCLEENISDIKDNISNVFESTVDDL QPPEFLNEAMIDLKSVLKSYETSMNYTLPSIDDEEEEEEKEEFKNGNNYSIKQIIQDMTEPFLECCNRIASDLPDNDSEI FTINCLDTVIIALQLFFTVTNFKIKQLQSRIEEISQVLLDRQYKKFLKESGLEPVMNDVNKYHELSMIPSNQLSEEEKNE IVELKRRMETGQLSKENLAELSFNLDNFLPSATMESTKFLFRLSSPRLGQEIIIGASKQFANDFSKLEKTILDIYNFEES KIYFPRTYMEVCVLLAIADDDDTVNKQAIIR
GO term prediction
Biological Process
GO:0006891 intra-Golgi vesicle-mediated transport
Molecular Function
None predicted.
Cellular Component
GO:0017119 Golgi transport complex