Protein

MCA_04899_1

Length
441 amino acids

Gene name: CPA1

Description: Carbamoyl-phosphate synthase arginine-specific small chain

Browser: contigC:4369218-4370544-

RNA-seq: read pairs 4187, FPKM 117.0, percentile rank 81.3% (100% = highest expression)

Protein function

Annotation:CPA1Carbamoyl-phosphate synthase arginine-specific small chain
KEGG:K01956carA carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
EGGNOG:0QEEECPA1carbamoylphosphate synthase
SGD closest match:S000005829CPA1Carbamoyl-phosphate synthase arginine-specific small chain
CGD closest match:CAL0000174966CPA1Carbamoyl-phosphate synthase arginine-specific small chain

Protein alignments

%idAln lengthE-value
MIA_00796_187.13%4430.0MIA_00796_1
A0A0J9XKE1_GEOCN88.40%4050.0Similar to Saccharomyces cerevisiae YOR303W CPA1 Small subunit of carbamoyl phosphate synthetase, which catalyzes a step in the synthesis of citrulline, an arginine OS=Geotrichum candidum GN=BN980_GECA22s01583g PE=3 SV=1
A0A167EYQ7_9ASCO84.52%4070.0Carbamoyl-phosphate synthase (Glutamine-hydrolyzing) CPA1 OS=Sugiyamaella lignohabitans GN=CPA1 PE=3 SV=1
A0A060SWG5_BLAAD79.56%4110.0ARAD1A01496p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A01496g PE=3 SV=1
A0A1E3PDZ7_9ASCO73.03%4190.0Small subunit of carbamoyl phosphate synthase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84272 PE=3 SV=1
UniRef50_Q5BB3775.97%4120.0Carbamoyl-phosphate synthase arginine-specific small chain n=264 Tax=Fungi TaxID=4751 RepID=CARA_EMENI
A0A1E4TM57_9ASCO73.89%4060.0Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1426 PE=3 SV=1
CARA_YARLI73.25%4150.0Carbamoyl-phosphate synthase arginine-specific small chain OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPA1 PE=3 SV=1
CARA_CANAL73.70%4030.0Carbamoyl-phosphate synthase arginine-specific small chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPA1 PE=3 SV=1
CARA_YEAST66.34%4130.0Carbamoyl-phosphate synthase arginine-specific small chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPA1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9770
Predicted cleavage: 27

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 441

Detailed signature matches

  1. Family IPR006274
    Carbamoyl-phosphate synthase, small subunit
    1. MF_01209 (CPSase_S_...)
    2. TIGR01368
  2. Domain IPR002474
    Carbamoyl-phosphate synthase small subunit, N-terminal domain
    1. SSF52021 (Carbamoyl...)
    2. G3DSA:3.50.30.20
    3. SM01097 (CPSase_sm_...)
    4. PF00988 (CPSase_sm_...)
  3. Domain IPR029062
    Class I glutamine amidotransferase-like
    1. G3DSA:3.40.50...
    2. SSF52317 (Class I g...)
  4. Domain IPR017926
    Glutamine amidotransferase
    1. PF00117 (GATase)
    2. PS51273 (GATASE_TYPE_1)
  5. Domain IPR035686
    Carbamoyl-phosphate synthase small subunit, GATase1 domain
    1. cd01744 (GATase1_CP...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. NON_CYTOPLASM... (N...)
  2. PR00096 (GATASE)
  3. PR00097 (ANTSNTHASEII)
  4. PR00099 (CPSGATASE)
  5. SIGNAL_PEPTIDE (Sig...)
  6. SIGNAL_PEPTID... (S...)
  7. SIGNAL_PEPTID... (S...)
  8. SIGNAL_PEPTID... (S...)

Residue annotation

  1. catalytic site cd0...
  2. subunit interface ...

Protein sequence

>MCA_04899_1
MFRFSKSFASRLPTTRRLFSSSSFLSKATPIASSIGSSTLDRATLTIRDGPVFHGKSFGANTNISGEAVFTTSLVGYPES
MTDPSYRGQIIVFTQPLIGNYGVPSSTARDEYNLLKYFESPHIQCIGIVVADIAMQYSHWTAVESLADWCQREGVAAITG
VDTRALVTFLRERGSSLARITIGEEYDADEDEAFVDPGAINLVHKVSTKSPFHVTAGARAHAHIAVIDCGVKENILRSLV
SRGADITVFPYDYPIHKIAHHFDGIFISNGPGDPTHCSSTVYNLKKTMETYEGPIFGICLGHQLLALAAGAKTIKLKYGN
RAHNIPALDLLSGRCHITSQNHGYAVDTSTLPSEFKPYFVNLNDQSNEGMIHVSRPIFSTQFHPEAKGGPLDSAFLFDKY
IEDVKEYKNKQTIALGAEHNTRPSPLLVDMLSKERVGVEVH

GO term prediction

Biological Process

GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
GO:0006541 glutamine metabolic process

Molecular Function

GO:0004088 carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity

Cellular Component

None predicted.