Protein

MCA_04824_1

Length
433 amino acids

Gene name: END3

Description: Actin cytoskeleton-regulatory complex protein END3

Browser: contigC:4177590-4178892-

RNA-seq: read pairs 2622, FPKM 74.6, percentile rank 73.9% (100% = highest expression)

Protein function

Annotation:END3Actin cytoskeleton-regulatory complex protein END3
KEGG:K20048END3 actin cytoskeleton-regulatory complex protein END3
EGGNOG:0QDVDEND3Component of the PAN1 actin cytoskeleton-regulatory complex required for the internalization of endosomes during actin-coupled endocytosis. The complex links the site of endocytosis to the cell membrane-associated actin cytoskeleton. Mediates uptake of external molecules and vacuolar degradation of plasma membrane proteins. Plays a role in the proper organization of the cell membrane-associated actin cytoskeleton and promotes its destabilization (By similarity)
SGD closest match:S000005028END3Actin cytoskeleton-regulatory complex protein END3
CGD closest match:CAL0000174035END3Actin cytoskeleton-regulatory complex protein END3

Protein alignments

%idAln lengthE-value
MIA_03722_171.20%4410.0MIA_03722_1
A0A0J9X531_GEOCN61.22%4416e-168Similar to Saccharomyces cerevisiae YNL084C END3 EH domain-containing protein involved in endocytosis, actin cytoskeletal organization and cell wall morphogenesis OS=Geotrichum candidum GN=BN980_GECA02s07655g PE=4 SV=1
A0A167DBU4_9ASCO57.05%4402e-162End3p OS=Sugiyamaella lignohabitans GN=END3 PE=4 SV=1
A0A060T292_BLAAD58.47%4314e-159ARAD1C29370p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29370g PE=4 SV=1
A0A1E3PMN6_9ASCO51.95%4372e-145Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51356 PE=4 SV=1
END3_YARLI51.28%4314e-135Actin cytoskeleton-regulatory complex protein END3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=END3 PE=3 SV=1
A0A1E4T9U1_9ASCO50.25%3963e-122Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_124246 PE=4 SV=1
UniRef50_Q6BY7748.57%3851e-112Actin cytoskeleton-regulatory complex protein END3 n=26 Tax=Saccharomycetales TaxID=4892 RepID=END3_DEBHA
END3_CANAL46.74%3832e-108Actin cytoskeleton-regulatory complex protein END3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=END3 PE=2 SV=1
END3_YEAST41.13%2483e-51Actin cytoskeleton-regulatory complex protein END3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=END3 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0120

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 400 433

Detailed signature matches

  1. Family IPR025604
    Actin cytoskeleton-regulatory complex protein End3
    1. PF12761 (End3)
  2. Domain IPR011992
    EF-hand domain pair
    1. SSF47473 (EF-hand)
  3. Domain IPR000261
    EH domain
    1. SM00027 (eh_3)
    2. PF12763 (EF-hand_4)
    3. PS50031 (EH)
  4. Domain IPR002048
    EF-hand domain
    1. PS50222 (EF_HAND_2)
    2. SM00054 (efh_1)
  5. SITE IPR018247
    EF-Hand 1, calcium-binding site
    1. PS00018 (EF_HAND_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.23...
  3. cd00052 (EH)
  4. mobidb-lite (disord...)

Residue annotation

  1. pseudo EF-hand loo...
  2. peptide binding po...
  3. Ca2+ binding site ...

Protein sequence

>MCA_04824_1
MPQIEQSEVQKYWEIFSGLNPISGKLSGEQAATVFKNSQLPDAQLGKIWDLADVDQDGQLDFEEFCIAMRLIFDIVNGVY
SSPPESLPEWLVPQSKSHLVEANEAIAGNPSPRRSSRYDDNDDEDLTLSSGFDWYISPSQRSEYSTIYTANADYHGLISF
DALTELYSTLDNVPRTDISSAWNLVNPRANDKIDKEQCIVFLHILSNRSKGYRIPRSVPASLRATFEKKQPEYSLNSSQS
VVRRRGDNNDEEDDEISSFSRNNHITADSSRKSSSTGGKKAFAEDYLTRLGLGGRSKTYESSQGTDFSSTKDTDWEEVRL
KRQLADLEDLIQKAESASQRRKRGLEDYNSSKTGLIKRELEQLLAYKEKQLIALRNGSLKKGLGLANDSERQSINEAKEE
VELLSSQVESLKQHQANRLKELENLRSQLQAAR

GO term prediction

Biological Process

GO:0006897 endocytosis
GO:0007015 actin filament organization

Molecular Function

GO:0005509 calcium ion binding
GO:0005515 protein binding

Cellular Component

None predicted.