Protein
MCA_04822_2
Length
122 amino acids
Gene name: RPL35
Description: Ribosomal 60S subunit protein L35A
Browser: contigC:4175014-4175747+
RNA-seq: read pairs 42058, FPKM 4225.0, percentile rank 99.2% (100% = highest expression)
Protein function
| Annotation: | RPL35 | Ribosomal 60S subunit protein L35A | |
|---|---|---|---|
| KEGG: | K02918 | RP-L35e | large subunit ribosomal protein L35e |
| EGGNOG: | 0PNQF | RPL35 | 60S ribosomal protein L35 |
| SGD closest match: | S000002350 | RPL35A | 60S ribosomal protein L35-A |
| CGD closest match: | CAL0000191177 | RPL35 | Ribosomal 60S subunit protein L35A |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_03724_1 | 74.38% | 121 | 1e-40 | MIA_03724_1 |
| A0A0J9XCV0_GEOCN | 63.74% | 91 | 9e-30 | Similar to Saccharomyces cerevisiae YDL136W RPL35B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA09s04124g PE=3 SV=1 |
| A0A060T8K4_BLAAD | 59.34% | 91 | 3e-27 | ARAD1C29414p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29414g PE=3 SV=1 |
| A0A1E3PLP2_9ASCO | 56.52% | 92 | 1e-25 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41738 PE=3 SV=1 |
| A0A1D8PK30_CANAL | 63.51% | 74 | 4e-24 | Ribosomal 60S subunit protein L35A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL35 PE=3 SV=1 |
| Q6CHD7_YARLI | 54.35% | 92 | 2e-23 | YALI0A09922p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A09922g PE=3 SV=1 |
| UniRef50_Q8L805 | 48.35% | 91 | 4e-19 | 60S ribosomal protein L35 n=26 Tax=Eukaryota TaxID=2759 RepID=RL35_WHEAT |
| RL35A_YEAST | 56.41% | 78 | 4e-19 | 60S ribosomal protein L35-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL35A PE=1 SV=1 |
| A0A1E4TL23_9ASCO | 50.54% | 93 | 5e-19 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87196 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0065
Protein family membership
- Ribosomal protein L29/L36 (IPR001854)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
-
cd00427 (Ribosomal_...)
Residue annotation
-
23S rRNA interface...
-
putative transloco...
-
signal recognition...
-
L23 interface cd00...
-
trigger factor int...
Protein sequence
>MCA_04822_2 MANPKTADYKKKSKSELEDELTLLKEELSKLRVQHASNQNTRSSKLGEVRKNIARVLTIIHTTQREQLKEFYAGKKYVPK DLRAKKTRAIRQRLTASQQQKKAARIQKKLAAFPQRKFAIKA
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome