Protein

MIA_03724_1

Length
125 amino acids


Browser: contig04:1977952-1978347-

Protein function

EGGNOG:0PNQFRPL3560S ribosomal protein L35
SGD closest match:S000002350RPL35A60S ribosomal protein L35-A
CGD closest match:CAL0000191177RPL35Ribosomal 60S subunit protein L35A

Protein alignments

%idAln lengthE-value
A0A0J9XCV0_GEOCN71.429%911.41e-38Similar to Saccharomyces cerevisiae YDL136W RPL35B Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA09s04124g PE=3 SV=1
A0A1E3PLP2_9ASCO60.870%928.53e-32Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_41738 PE=3 SV=1
A0A060T8K4_BLAAD58.065%1241.42e-30ARAD1C29414p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29414g PE=3 SV=1
UniRef50_F4P64357.609%921.91e-23Putative uncharacterized protein n=89 Tax=Eukaryota TaxID=2759 RepID=F4P643_BATDJ
RL35A_YEAST61.538%782.86e-2560S ribosomal protein L35-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL35A PE=1 SV=1
Q6CHD7_YARLI57.609%923.81e-25YALI0A09922p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A09922g PE=3 SV=1
A0A1D8PK30_CANAL56.410%784.55e-24Ribosomal 60S subunit protein L35A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL35 PE=3 SV=1
A0A1E4TL23_9ASCO49.462%931.84e-20Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87196 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0695

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. 23S rRNA interface...
  2. putative transloco...
  3. signal recognition...
  4. L23 interface cd00...
  5. trigger factor int...

Protein sequence

>MIA_03724_1
MLTRANPKTAEFQNKSKAELEEELQSLKEELNKLRVQHASNSNVKSSKLNDVRKSIARILTIIHNTQREQLAELYKGKKY
VPKDLRAKQTRAIRRRLTASQLNAKTPAQLKKAAAFPQRKFAIKA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome