MCA_04784_1
Gene name: ATP1
Description: ATP synthase subunit alpha, mitochondrial
Browser: contigC:4019460-4021645+
RNA-seq: read pairs 132222, FPKM 2992.2, percentile rank 98.4% (100% = highest expression)
Protein function
| Annotation: | ATP1 | ATP synthase subunit alpha, mitochondrial | |
|---|---|---|---|
| KEGG: | K02132 | ATPeF1A | F-type H+-transporting ATPase subunit alpha |
| EGGNOG: | 0PFSM | ATP1 | Produces ATP from ADP in the presence of a proton gradient across the membrane (By similarity) |
| SGD closest match: | S000000195 | ATP1 | ATP synthase subunit alpha, mitochondrial |
| CGD closest match: | CAL0000188156 | ATP1 | ATP synthase subunit alpha |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_02881_1 | 92.49% | 546 | 0.0 | MIA_02881_1 |
| A0A0J9X2Q8_GEOCN | 90.46% | 545 | 0.0 | ATP synthase subunit alpha OS=Geotrichum candidum GN=BN980_GECA01s09107g PE=3 SV=1 |
| A0A1E3PIP2_9ASCO | 84.19% | 544 | 0.0 | ATP synthase subunit alpha OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_25413 PE=3 SV=1 |
| Q6C326_YARLI | 83.36% | 541 | 0.0 | ATP synthase subunit alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F03179g PE=1 SV=1 |
| A0A1D8PDC4_CANAL | 84.10% | 522 | 0.0 | ATP synthase subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATP1 PE=3 SV=1 |
| A0A060T1H4_BLAAD | 83.09% | 544 | 0.0 | ATP synthase subunit alpha OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C16500g PE=3 SV=1 |
| ATPA_YEAST | 82.17% | 544 | 0.0 | ATP synthase subunit alpha, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP1 PE=1 SV=5 |
| UniRef50_P07251 | 82.17% | 544 | 0.0 | ATP synthase subunit alpha, mitochondrial n=329 Tax=cellular organisms TaxID=131567 RepID=ATPA_YEAST |
| A0A1E4THU0_9ASCO | 80.96% | 541 | 0.0 | ATP synthase subunit alpha OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32002 PE=3 SV=1 |
| A0A167EJC4_9ASCO | 86.58% | 447 | 0.0 | ATP synthase subunit alpha OS=Sugiyamaella lignohabitans GN=ATP1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9977
Predicted cleavage: 42
Protein family membership
- ATP synthase, F1 complex, alpha subunit (IPR005294)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches
no IPR
-
-
-
SSF47917 (C-termina...)
Residue annotation
-
beta subunit inter...
-
Walker A motif cd0...
-
ATP binding site c...
-
Walker B motif cd0...
Protein sequence
>MCA_04784_1 MLRTVLRQSARRVGVSATQRFALATPSLVARRGFAEAKATPTEVSSILEERIRGVSGEADLSETGRVLSVGDGIARVFGL NKVQAEELVEFSSGVKGMALNLEAGQVGIVLFGSDRLVKEGETVKRTGSIVDVPVGPGLLGRVVDALGNPIDGKGPIEST EKIRAQVKAPGILPRRSVHEPMQTGLKSVDALVPIGRGQRELIIGDRQTGKTTVAIDSILNQKRWNTGSDESKKLYCVYV AVGQKRSTVAQLVQTLEQNDALKYTIIVAATASEAAPLQYLAPFTGCAIGEWFRDNGRHALIIYDDLSKQAVAYRQMSLL LRRPPGREAYPGDVFYLHSRLLERAAKMSEKHGGGSLTALPIIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPA INVGLSVSRVGSAAQVKAMKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKLTLSRGERLTQILKQKQSSPLGAEEQVPI VFAGVNGFLDNIPVNEVGRFESEFLSYLKANESEILSAIVEKGELSKELLAKLKGAAETFSANFA
GO term prediction
Biological Process
GO:0015986 ATP synthesis coupled proton transport
GO:0015992 proton transport
GO:0046034 ATP metabolic process
Molecular Function
GO:0005524 ATP binding
GO:0032559 adenyl ribonucleotide binding
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Cellular Component
GO:0045261 proton-transporting ATP synthase complex, catalytic core F(1)