Protein

MCA_04525_1

Length
307 amino acids

Gene name: DST1

Description: Transcription elongation factor S-II

Browser: contigC:3279920-3280927+

RNA-seq: read pairs 1180, FPKM 47.3, percentile rank 64.2% (100% = highest expression)

Protein function

Annotation:DST1Transcription elongation factor S-II
KEGG:K03145TFIIS transcription elongation factor S-II
EGGNOG:0PFX1DST1transcription elongation factor SII
SGD closest match:S000003011DST1Transcription elongation factor S-II
CGD closest match:CAL0000174383orf19.4537Uncharacterized protein

Protein alignments

%idAln lengthE-value
MIA_03405_169.04%3233e-144MIA_03405_1
A0A0J9XGJ8_GEOCN59.16%3117e-120Similar to Saccharomyces cerevisiae YGL043W DST1 General transcription elongation factor TFIIS OS=Geotrichum candidum GN=BN980_GECA16s01275g PE=4 SV=1
A0A060TJ04_BLAAD58.67%3007e-107ARAD1D42856p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D42856g PE=4 SV=1
Q6C6I8_YARLI54.00%3002e-97YALI0E09196p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E09196g PE=4 SV=1
UniRef50_Q6C6I854.00%3004e-94YALI0E09196p n=6 Tax=Saccharomycetales TaxID=4892 RepID=Q6C6I8_YARLI
A0A1E4TEF5_9ASCO48.00%3007e-94Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1801 PE=4 SV=1
A0A1E3PEF7_9ASCO53.49%3011e-90Transcription elongation factor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52797 PE=4 SV=1
Q59T94_CANAL45.42%3065e-80Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4537 PE=4 SV=1
A0A167CJP6_9ASCO63.54%1819e-74Dst1p OS=Sugiyamaella lignohabitans GN=DST1 PE=4 SV=1
TFS2_YEAST38.51%3099e-66Transcription elongation factor S-II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DST1 PE=1 SV=4

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0404

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 307

Detailed signature matches

  1. Family IPR035100
    Transcription elongation factor, IIS-type
    1. PIRSF006704 (TFIIS)
  2. Family IPR006289
    Transcription elongation factor, TFIIS
    1. TIGR01385
  3. Domain IPR017923
    Transcription factor IIS, N-terminal
    1. SSF47676 (Conserved...)
    2. PS51319 (TFIIS_N)
    3. PF08711 (Med26)
  4. Domain IPR003617
    Transcription elongation factor, TFIIS/CRSP70, N-terminal, sub-type
    1. SM00509 (TFS2_5)
  5. Domain IPR003618
    Transcription elongation factor S-II, central domain
    1. PF07500 (TFIIS_M)
    2. PS51321 (TFIIS_CENTRAL)
    3. G3DSA:1.10.47...
    4. SM00510 (mid_6)
    5. SSF46942 (Elongatio...)
  6. Domain IPR001222
    Zinc finger, TFIIS-type
    1. PS51133 (ZF_TFIIS_2)
    2. PF01096 (TFIIS_C)
    3. PS00466 (ZF_TFIIS_1)
    4. SM00440 (Cys4_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:1.20.93...
  2. G3DSA:2.20.25.10
  3. SSF57783 (Zinc beta...)
  4. cd13749 (Zn-ribbon_...)
  5. mobidb-lite (disord...)

Residue annotation

  1. trimer interface c...
  2. Zn binding site cd...

Protein sequence

>MCA_04525_1
MTSSVSPLDVNEIRSLMHDLEKASGSKERILSLLSVFEERVRPTEKLLRETKLGIAVNKYRSHEDKAVSDMVKKIIKKWK
DQVSSQKAALKHKHHHASTTSTSTSNSSQNTTTASSNSNGSSSSASTNGKVRTAASDGAKTAIHDDKVRNSCLELLYNAL
VIDSSVSTSEVLAVAKEVEEAVFVGEKGVTSGYRAKIRSLVSNLRDRKNPNLRKRVVSGEISGKKLYSMSPQEMASDEIK
KDIEQFKKENLFNAQAAVQKNAVTDRFTCGKCKQKKVSYFQMQTRSADEPLTTFCTCENCGNRWKFS

GO term prediction

Biological Process

GO:0006351 transcription, DNA-templated
GO:0006355 regulation of transcription, DNA-templated

Molecular Function

GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding

Cellular Component

GO:0005634 nucleus