Protein

MCA_04509_1

Length
257 amino acids

Gene name: NHP6C

Description: Non-histone chromosomal protein 6; contains two HMG box domains; probably mitochondrial

Browser: contigC:3214379-3215153+

RNA-seq: read pairs 8790, FPKM 421.0, percentile rank 93.7% (100% = highest expression)

Protein function

Annotation:NHP6CNon-histone chromosomal protein 6; contains two HMG box domains; probably mitochondrial
EGGNOG:0PRUPNHP6DNA-binding protein that induces severe bending of DNA. Required for DNA-binding by the FACT complex, a general chromatin factor that acts to reorganize nucleosomes. The FACT complex is involved in multiple processes that require DNA as a template such as mRNA elongation, DNA replication and DNA repair. Also augments the fidelity of transcription by RNA polymerase III independently of any role in the FACT complex
SGD closest match:S000002157NHP6BNon-histone chromosomal protein 6B
CGD closest match:CAL0000201490NHP6Non-histone chromosomal protein 6

Protein alignments

%idAln lengthE-value
UniRef50_A0A0G4J3E438.00%1504e-28Uncharacterized protein n=2 Tax=Plasmodiophoridae TaxID=37358 RepID=A0A0G4J3E4_PLABS
NHP6B_YEAST65.15%661e-25Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHP6B PE=1 SV=3
A0A0J9XI96_GEOCN33.80%1421e-23Similar to Saccharomyces cerevisiae YMR072W ABF2 Mitochondrial DNA-binding protein, involved in mitochondrial DNA replication and recombination and member of HMG1 DNA-binding protein family OS=Geotrichum candidum GN=BN980_GECA19s00538g PE=4 SV=1
A0A1E4THC9_9ASCO60.29%684e-24Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31873 PE=4 SV=1
NHP6_CANAL58.82%682e-23Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NHP6 PE=3 SV=1
NHP6_YARLI51.95%772e-22Non-histone chromosomal protein 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NHP6 PE=3 SV=1
MIA_05499_156.92%653e-22MIA_05499_1
A0A167EYL2_9ASCO52.11%711e-21Nhp6bp OS=Sugiyamaella lignohabitans GN=NHP6B PE=4 SV=1
A0A1E3PEI4_9ASCO54.69%645e-20Non-histone chromosomal protein 6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_28285 PE=4 SV=1
A0A060SYZ3_BLAAD48.65%744e-19ARAD1A15532p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A15532g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9792
Predicted cleavage: 15

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 257

Detailed signature matches

  1. Domain IPR009071
    High mobility group box domain
    1. G3DSA:1.10.30.10
    2. SM00398 (hmgende2)
    3. PS50118 (HMG_BOX_2)
    4. PF00505 (HMG_box)
    5. SSF47095 (HMG-box)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. PR00886 (HIGHMOBLTY12)
  3. cd01390 (HMGB-UBF_H...)
  4. mobidb-lite (disord...)

Residue annotation

  1. DNA binding site c...
  2. DNA binding site c...

Protein sequence

>MCA_04509_1
MFSSRVLSPSLRNAKQLINTAIPATASALQLLNKTTPNQANMFHTTGMPLSPPKKVKLDEYVNTEEIKPTAKRQRKASPK
GDAKKKSKDDKKDKKKKRDPNAPKRSLSAYMYFSTEMRPIVKEESPAASFQDIGKILGQRWNSLSAEEKLPFEQKAQADK
ARYEHEMEEYNRMVSANAPPKRFMSAYMFFANSNRDDVKLQSPQATFADVGKILGEKWKSLTPEEKAPYENMAQSDKSRY
ESQMEEFRLSHPEINEN

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.