Protein

MCA_04466_1

Length
176 amino acids


Gene name: RPL6B

Description: 60S ribosomal protein L6-B

Browser: contigC:3121008-3121917-

RNA-seq: read pairs 63096, FPKM 4404.6, percentile rank 99.4% (100% = highest expression)

Protein function

Annotation:RPL6B60S ribosomal protein L6-B
KEGG:K02934RP-L6e large subunit ribosomal protein L6e
EGGNOG:0PJFVFG01016.160S ribosomal protein L6
SGD closest match:S000004440RPL6B60S ribosomal protein L6-B
CGD closest match:CAL0000181737RPL660S ribosomal protein L6

Protein alignments

%idAln lengthE-value
MIA_01169_186.86%1751e-75MIA_01169_1
A0A1E3PK79_9ASCO71.68%1731e-5560S ribosomal protein L6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_46451 PE=3 SV=1
UniRef50_G8BQB763.89%1801e-5160S ribosomal protein L6 n=23 Tax=Fungi TaxID=4751 RepID=G8BQB7_TETPH
A0A1D8PCX8_CANAL70.93%1723e-5360S ribosomal protein L6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL6 PE=3 SV=1
RL6B_YEAST64.97%1773e-5360S ribosomal protein L6-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL6B PE=1 SV=4
A0A060TG34_BLAAD68.02%1721e-52ARAD1D27720p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D27720g PE=4 SV=1
A0A0J9XDT1_GEOCN73.41%1732e-52Similar to Saccharomyces cerevisiae YML073C RPL6A N-terminally acetylated protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA11s02375g PE=4 SV=1
Q6C4C8_YARLI64.91%1716e-4860S ribosomal protein L6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E27830g PE=3 SV=1
A0A1E4TAL3_9ASCO51.16%1723e-38Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128055 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1111

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 20 40 60 80 100 120 140 160 176

Detailed signature matches

    1. PF01159 (Ribosomal_L6e)
    1. SSF50104 (Translati...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd13156 (KOW_RPL6)

Residue annotation

  1. RNA binding site c...

Protein sequence

>MCA_04466_1
MTVRGAKNWYPTEDLVKKSKPEAQNPTKLRASLVPGTILIILAGRFRGKRVVYLKPLEDNTLLVSGPFKVNGVPLRRVNP
RYVIATSTSIDVSKVDVSKYDVSFFASEKKDKNAATEEEFFGDKKEKKEVKAERVAAQKEVDAALLAEIKKQPLLKKYIA
TSFSLKNGDKPHLLKF

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome