MCA_04338_1
Gene name: PUS4
Description: tRNA pseudouridine synthase 4; catalyzes only the formation of pseudouridine-55 (Psi55), a highly conserved tRNA modification, in mitochondrial and cytoplasmic tRNAs
Browser: contigC:2745193-2746711+
RNA-seq: read pairs 907, FPKM 22.1, percentile rank 44.1% (100% = highest expression)
Protein function
| Annotation: | PUS4 | tRNA pseudouridine synthase 4; catalyzes only the formation of pseudouridine-55 (Psi55), a highly conserved tRNA modification, in mitochondrial and cytoplasmic tRNAs | |
|---|---|---|---|
| KEGG: | K03177 | truB | tRNA pseudouridine55 synthase [EC:5.4.99.25] |
| EGGNOG: | 0PFSU | PGUG_03368 | Pseudouridine synthase |
| SGD closest match: | S000005236 | PUS4 | tRNA pseudouridine synthase 4 |
| CGD closest match: | CAL0000191725 | PUS4 | Pseudouridine synthase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MIA_05227_1 | 49.43% | 350 | 2e-104 | MIA_05227_1 |
| A0A0J9X6U9_GEOCN | 45.20% | 354 | 2e-78 | Similar to Saccharomyces cerevisiae YNL292W PUS4 Pseudouridine synthase, catalyzes only the formation of pseudouridine-55 (Psi55), a highly conserved tRNA modification OS=Geotrichum candidum GN=BN980_GECA04s04850g PE=3 SV=1 |
| UniRef50_A0A0J9X6U9 | 45.20% | 354 | 3e-75 | Similar to Saccharomyces cerevisiae YNL292W PUS4 Pseudouridine synthase, catalyzes only the formation of pseudouridine-55 (Psi55), a highly conserved tRNA modification n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X6U9_GEOCN |
| A0A060T396_BLAAD | 40.47% | 341 | 7e-67 | ARAD1C38896p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C38896g PE=3 SV=1 |
| A0A167CLJ8_9ASCO | 37.53% | 373 | 1e-63 | Pseudouridine synthase PUS4 OS=Sugiyamaella lignohabitans GN=PUS4 PE=3 SV=1 |
| A0A1E3PP18_9ASCO | 35.28% | 360 | 3e-61 | Pseudouridine synthase (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_11695 PE=3 SV=1 |
| A0A1D8PN62_CANAL | 35.57% | 357 | 2e-57 | Pseudouridine synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PUS4 PE=3 SV=1 |
| PUS4_YEAST | 37.66% | 385 | 6e-57 | tRNA pseudouridine synthase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUS4 PE=1 SV=1 |
| A0A1E4TJ25_9ASCO | 35.11% | 376 | 8e-50 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30105 PE=3 SV=1 |
| Q6C7U6_YARLI | 38.54% | 205 | 7e-29 | YALI0D25234p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D25234g PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9596
Predicted cleavage: 17
Protein family membership
- tRNA pseudouridine synthase II, TruB (IPR014780)
Domains and repeats
-
Domain
-
Domain
Detailed signature matches
no IPR
-
-
-
mobidb-lite (disord...)
Protein sequence
>MCA_04338_1 MFLTQFKGPFKSLARFTSTRSIFFLNHTASNNNSAKNKNSSSTITNQTQETSSSVKQSSFKDSQFSQQQHNRKQQQQQQE KIKMGGIFAVNKPSGPSSAEVVSKIKYTLNGTPLIETSRAWYKEDKSRFKQAMNEGRGKNNNKWSRKKAVSKDIKVGHGG TLDPLASGVLVIGYGDGTRDLQGYLTGKMRKVYECTAIFGASTTTYDITGDLVEYASTDSVVSKLTESLLEDTIKAKFLG DIIQYPPVYSAIKMDGRALYDYARSGEPLPRKIAHRESKVDMFSVVPNTFEVVSKAQLEADNEFPEREASEQDRAFYARE MQPPVPDTGLSTASCPDSFVRVRLEFDVSSGTYIRSLVHDLARELGSFAYMSKLVRKSVGPFELGKNVFEIEDLTERYEE ESWVKMLETMATHPTKEITIDMLKETIKPIPRQPKQEETKKSAEKIDNTKPEEIKSEEKEETKAKSEETEQSKSTEEEEE PKKRKEAPEQEDEEGPDTKSFKTEQ
GO term prediction
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006396 RNA processing
GO:0009451 RNA modification
Molecular Function
GO:0003723 RNA binding
GO:0009982 pseudouridine synthase activity
Cellular Component
None predicted.